KEGG   Bombus impatiens (common eastern bumble bee): 100740693Help
Entry
100740693         CDS       T04362                                 

Definition
(RefSeq) TGF-beta receptor type-1 isoform X2
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim04068  FoxO signaling pathway
bim04144  Endocytosis
bim04350  TGF-beta signaling pathway
bim04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:bim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100740693
   04068 FoxO signaling pathway
    100740693
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100740693
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100740693
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bim01001]
    100740693
Enzymes [BR:bim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100740693
Protein kinases [BR:bim01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   100740693
Cytokine receptors [BR:bim04050]
 TGF-beta receptors
  Type I TGF-beta receptor
   100740693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp APH Pkinase_fungal FTA2 DUF2735
Motif
Other DBs
NCBI-GeneID: 100740693
NCBI-ProteinID: XP_003485727
Position
Unknown
AA seq 523 aa AA seqDB search
MRGACDGGIASFLALALLCLFHTSCIVDGLLKCYCDICTDTNHTCETDGYCFASTSLEND
MTTYARRCYDKVRFFPAPEYSVWCKANNTLHGPGDVEYAVACCDHSDFCNRDLRPSFTPR
ESRGGPYFRLVDYLERVRSGGDDTAWVTWKMALMIAMPICVICVVVMVIYHVRKTPERPG
NSDDSQEAPDRPILGGVTIRDMLEMTTSGSGSGLPLLVQRSIARQIQLVETIGKGRFGEV
WRGRWRGENVAVKIFSSREERSWFREAEIYQTVMLRHDNILGFIAADNKDNGTWTQLWLI
TDYHEKGSLFDYLNRSTVDTNGMIRMALSIATGLAHLHMEIVGTQGKPAIAHRDLKSKNI
LVKTNGTCAIGDLGLAVRHDVITDTVDIQLNNRVGTKRYMAPEVLEETINMNHFDSFKRA
DVYALGLILWEIARRCNVGGIHDEYQLPFYDLVPSDPTIEEMRKVVCTDRQRPSIPNRWQ
SIEALQVMSKVMKECWYHNAAARLTALRIKKSLANYGAMEDLK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcgcgtgcgacggcggcatagcgagctttctcgctctggcgctcctctgttta
ttccacacgtcatgcattgtggacggactgttgaagtgttattgcgatatttgtacggac
accaatcacacgtgcgaaaccgatggttattgcttcgctagcaccagcttggagaatgat
atgaccacatatgcccggaggtgttatgataaggtgcgcttcttcccggcgcccgaatac
tcagtctggtgcaaagcgaataacacgctacacggtccaggtgacgtggaatacgcggtc
gcctgctgcgaccactccgacttctgcaatcgcgacctaaggccctcttttactcctcgc
gagtccagaggtgggccatacttccgactcgtcgattacctcgaacgagtgcggtcgggt
ggcgatgacacggcgtgggtcacttggaaaatggccttgatgatagcaatgccaatatgc
gtgatctgcgtggtggttatggtcatttatcacgtgcgtaagaccccagaaaggccagga
aatagcgatgattcgcaggaggcaccagatcgacccatcctgggtggtgttaccatcagg
gatatgctggaaatgactaccagtggtagtggctcaggcctgccgcttctggtacagcga
agcatagcccgccagattcagctggtggagacgattggaaaaggtcgcttcggcgaggtc
tggcgtggtcgttggagaggtgagaacgttgccgtgaagatcttcagctcgcgtgaagaa
aggtcttggttcagggaggccgaaatttatcagacggtgatgctcagacacgataatatc
ctcggcttcatcgcagctgataacaaagataatggtacgtggacccagctgtggttgatc
acagattatcacgagaagggttcgctgttcgattatttgaatagatcgaccgttgatacg
aacggtatgatcaggatggctctgtcgattgccaccgggttagcgcatcttcacatggag
atcgttggcacgcaagggaaaccagccatcgctcacagggatctcaagtcgaaaaatatc
ctcgtgaagacgaatggcacatgcgcgatcggcgatcttggattggccgtcagacatgat
gtaataacagacaccgtcgatatccaactaaataatcgggtgggcactaagcggtacatg
gcacctgaggttctcgaagagacgataaacatgaaccactttgattccttcaagagggct
gacgtgtacgctctcgggctgatcctctgggagatcgcaaggcgatgcaacgtcggcgga
attcacgacgaatatcagctgccgttttacgacttggtgccttctgatccgacgatcgaa
gagatgcgtaaggttgtgtgtaccgacagacagaggccatcgataccgaatcggtggcag
tcgatcgaggcgttacaagttatgtcgaaggtgatgaaggagtgttggtatcacaacgcg
gcagctaggctaaccgcgcttaggattaaaaaatctctcgcaaactacggtgcgatggag
gacttgaagtga

DBGET integrated database retrieval system