KEGG   Bombus impatiens (common eastern bumble bee): 100741269Help
Entry
100741269         CDS       T04362                                 

Definition
(RefSeq) biotin--protein ligase isoform X1
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00780  Biotin metabolism
bim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    100741269
Enzymes [BR:bim01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     100741269
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     100741269
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     100741269
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     100741269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C BPL_N
Motif
Other DBs
NCBI-GeneID: 100741269
NCBI-ProteinID: XP_003492639
Position
Unknown
AA seq 988 aa AA seqDB search
MILTFLYMIATSIQSRRIVFLKNHLRNLFQGDTTTCPSIMFYNKKQSSNKESNSPMNDCE
NDEFMTSCLCVNKRDARLEELLWYYDDMRLCTIFPQQKVDISSWLTYQYGKTFFPLHTNN
RNGTLLQSEYKLYILVEADLKSYNPIAATHATKVEDYGLIITWTANKNIDLIIESDLDMV
AKFLIAAMEGQCYINNGLLLKRIETVLISGKPCLYNSDVLNSPPTKKFIDKEEWTTHAEK
LKSLSDTAKLVSEKCKPFEVKDLPGLIVYPENAVTDAELELMKRVESNETLESETRSQVS
TPVSVNIPQHENQLSQDEIQKITKDTAEFQGVPHSTSKSLDMLDNLDVSSTINTRQVSCS
DIKSTSKSFEPKSFYDAKYSKSIASTSPFKNSIAEITRKLSKNNVRPPNVLIYADSFIAR
NNVKGVLEESLDTNKYTIYALSPEEARNDAWVENAALVVVCGNVGNEIGNRIVEYILHGG
KLLALCSDVIHILLPSFKTAEVRENELVHFSYGKWKHVRMMHHIFCYQASPVRTRFSQDH
EDVKVSSVSPPATVSVKDKKGNSHSFDLKVLGTEETWHTPSILLATLLGSGGKLVFSQIH
LEVDPMQYELEESKFNALKESNATRLEIFNDLLKTHLEIEVRSTAKLTAHITYTSAFFLG
RHELKLEMLERLKDVMTANDSLKMPKLEIQFCRSSTVPRPASALFLPIMIHQCPDNFSTV
EYFENLSTKELGRLVIYVDIMTSSMDVFNGHQLGHGLAVIVRQQTQGRGRSKNIWLSPKG
AALFTLQLHVPTDTILGRRISILQHLVSVAIISAFKSLSGYEDIDLRLKWPNDIYAGNNV
KIGGLIVETHILSDLNICNVGVGINLFNKEPTCCINDIVTTFNEIYQKKLEMISYEQYFA
IVFNEIERWLNIVQSGNIDDFLDAYYTYWMHTDTNVTVLSASGVSQNVKILGIDDYGYLR
VRGEDGTMFTVHPDGNTFDCLKGLIAPK
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgacatttctttatatgatagcaacatcaatccagtcaaggaggattgtattt
ttaaaaaatcatttacgtaatttatttcaaggagatacaaccacttgcccatcaataatg
ttttataataaaaaacaaagttcaaataaagaatcaaattctcctatgaatgattgtgaa
aatgatgaatttatgacttcttgtctatgtgtgaataaacgtgatgctagactagaagaa
ttactatggtactatgatgatatgagattgtgcactatatttccacaacaaaaagttgac
atctcaagttggttaacgtatcagtatggaaaaacattttttcctttgcatacaaataat
cgcaatggaactttgttacaatcagagtacaaactttatattcttgttgaagctgatctt
aaaagttataatcctattgctgcaacacatgctactaaggtcgaggattacggtttaatt
attacgtggacggcaaataaaaatattgatttaattatagagtccgatttagatatggtt
gcaaaatttcttattgcagcaatggaaggtcaatgttacattaataatggcttgttattg
aaacgaatagaaactgtcctgatatcaggaaagccttgtctttacaatagtgatgtgttg
aattcaccaccaactaaaaaatttatagacaaagaggaatggacaacgcatgcagaaaaa
ttaaaatcattaagcgacactgccaaactcgtatccgagaaatgcaaaccatttgaagta
aaggatcttccaggtttaatagtatatccagaaaatgctgtaacagacgcagaacttgaa
ctgatgaagcgtgtggagtccaatgaaacgttagagagtgaaactagaagtcaagtttct
acaccagtttcagtaaacattcctcaacatgagaatcaattatcacaagatgaaatacaa
aagatcacaaaagataccgctgaatttcaaggtgttccacattctactagtaaatcactt
gatatgcttgacaatttggatgtatccagtactataaacaccagacaagtatcttgcagt
gatataaaaagtacaagtaaatcttttgaaccaaagtctttttatgatgctaagtatagt
aaatccatagcatctacaagcccttttaagaattccatagcggagataacaagaaagtta
tcaaaaaataatgtaagaccaccaaatgtcctaatatatgctgatagttttattgcacgt
aacaatgtaaaaggtgttttggaagaatctcttgacacaaataaatacaccatttacgca
ttatctccagaagaagcacgtaatgacgcttgggtagaaaatgcagctttagtcgtcgtt
tgtggaaatgttggcaatgagattggaaaccgaatcgtggagtatattcttcacggtggc
aagttgctcgctttgtgctccgacgtaattcatattttacttccatcgtttaaaacggca
gaagtacgagaaaacgaactggttcatttttcttatgggaaatggaagcatgtacgcatg
atgcatcatatcttctgttatcaagcatcccctgtaagaacgagattttcacaggatcat
gaagacgtaaaagtatctagtgtgtctccgccagcgacagtgagcgtgaaagataaaaag
ggaaactctcattcgtttgatctaaaggtacttggaacggaagaaacttggcacacacca
agtattctacttgccaccctactaggaagtggcggaaagcttgttttttctcaaatacat
ctagaagtggatccaatgcaatatgaactcgaggaaagtaaatttaatgctttgaaagaa
agtaacgcaactagactggaaatattcaatgatttattaaaaacgcatcttgaaatagaa
gttcgtagtactgcaaaactaactgcacatataacttatacgtctgctttctttttggga
cgacatgagttgaaactagaaatgctagaaagattgaaggatgtaatgacagcaaacgat
agtttaaaaatgccaaagctggaaattcagttttgtagaagcagcacagttccacgacct
gcttcagctttgttcctaccaattatgattcatcagtgtcctgacaatttctcaaccgta
gaatattttgagaatttatctaccaaggaattagggcgtttggttatatacgttgatata
atgacatcatcaatggatgtatttaatggtcatcaattaggacatggtttagctgttatt
gtccgtcagcaaactcaaggtcgaggaaggagtaaaaatatttggctcagtccaaaaggt
gcagcactattcacgttgcaacttcatgtgcctaccgataccatacttggaagacgaatc
tcaattttgcaacatttggtttctgttgcaattatatccgcatttaagtctctatctgga
tatgaagatatcgatttaagattaaaatggcctaatgatatttatgctggtaataatgtt
aaaattggtggactgattgtagaaactcatatcttgtcggatcttaatatatgtaatgtt
ggagttggaataaatttgttcaataaagaacctacatgttgcatcaatgatatagttact
acatttaacgaaatatatcagaaaaagttagaaatgatatcatacgaacaatactttgct
attgtattcaatgaaattgaaagatggttaaatatcgtacaaagtggtaatatagatgat
tttctggatgcatattatacttattggatgcacaccgacacaaatgtgacggtattatca
gcatctggggtgtcacaaaacgttaaaatactaggtatagacgattacggatatttacgt
gtacgaggagaagatggaacgatgtttaccgtacatccagatggtaatacgttcgattgt
ctgaaaggtcttatagctccgaaataa

DBGET integrated database retrieval system