KEGG   Bombus impatiens (common eastern bumble bee): 100741692Help
Entry
100741692         CDS       T04362                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:bim00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100741692
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bim03041]
    100741692
Enzymes [BR:bim01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100741692
Spliceosome [BR:bim03041]
 Complex C
  Other components
   Step II factors
    100741692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA_16
Motif
Other DBs
NCBI-GeneID: 100741692
NCBI-ProteinID: XP_003486410
Position
Unknown
AA seq 1197 aa AA seqDB search
MDEVAKLEHLSLVSKICTELENHLGLNDKDLAEFIIHLAEKNDTFDKFKKVLIENGAEFS
ESFMANLLRIIQHMKPTKLEEKSLKPPTKQDELAQKFPALALPNEEPKIVDEKELKDDDI
VSSAMASLEELAPSKKSNKEDSKKENQSIDNNDKKNKHARRSRSRDRRRHRSRSSGRRDR
RHRSRSRSRSRDRSRSRDRRRHRSRDRKRSRSRDRKFHRDKYSNKLDRSRSRSVEELSMD
PEVGKIYSGKVANIVPFGCFVQLEGLKRRWEGLVHISQLRREGRVASASDVVSRGQKVLV
KVLNIGGQKVSLSMKDVDQETGRDLNPVVAVTKTEEDEKHLRNPDRPTSLLELQGNWDED
ETYSRKRVQRLSSPEKWEIKQMLAASCIDRSELPEFDTETGILPREDDEEEDVEIELVEE
EPPFLHGHGRALGDLSPVRIVKNPDGSLAQAAMMQSALAKERREQKMLQREQEMDSVPTG
LNKNWIDPLPEAESRTLAANMRGIGLQTQDLPEWKKHVIGGKKSSFGKKTNLTLLEQRQS
LPIYKLRDDLVKAVTDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAM
SVAKRVAEEFGCRLGQEVGYTIRFEDCTGPETNIKYMTDGMLLRECLMDLDLKTYSVIML
DEAHERTIHTDVLFGLLKQAVGRRPDLKLIVTSATLDAVKFSQYFFEAPIFTIPGRTFEV
EVMYTKEPETDYLDAALITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDV
PELIILPVYSALPSEMQTRIFEPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKV
YNSKTGMDSLIVTPISQAAAKQRAGRAGRTGPGKCYRLYTERAYRDEMLPTPVPEIQRTN
LATTVLQLKTMGINDLLHFDFMDAPPVESLIMALESLHSLSALDNEGLLTRLGRRMAEFP
LEPNLSKMLIMSVHLQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQPEGDHLT
LLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGKNTVRIQ
KAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMRE
VTTIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISRVRRRRN
NT seq 3594 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagttgcaaagctcgaacacctgtctttggtttcgaaaatatgcacggaattg
gaaaatcacttagggctaaatgacaaagatttggctgaattcataatccatttggcagag
aaaaatgatacatttgataaatttaaaaaagttctcattgaaaatggtgctgaattttct
gaatcttttatggccaatttgctaagaataatacaacatatgaagccaactaaattggag
gagaaatcattgaaacctccgacaaagcaagatgaactagctcaaaaattccctgcccta
gcactgccaaacgaggaaccaaaaattgtggatgaaaaagaactcaaagacgatgatata
gtcagcagtgctatggcaagtttggaggaactagcaccatcaaaaaagtctaacaaagaa
gatagcaagaaagaaaaccaatcaatcgataataatgataagaagaacaaacacgcaaga
agaagtagatcaagagatagaagaagacacagatcacgttcatcaggtcgcagagacaga
aggcataggtctagatctcgttcaaggtcacgagatcgttcaagatccagagatagaaga
cgtcacaggtccagagatcgtaaaagatctagatcacgagacagaaaatttcatagggac
aaatattccaataaacttgatcgatctagatcgcgatctgtagaagaactttccatggat
ccagaagtaggcaagatctattcaggcaaagtagctaatatcgtaccttttggttgtttt
gttcaattggagggtttgaaacgaaggtgggaagggcttgttcatatctcacaattaaga
agggaaggaagagtcgccagtgctagcgatgtagtatctaggggtcagaaggtgctcgtg
aaagtcctcaatattggtggacaaaaggtttctttaagtatgaaggatgttgatcaggaa
accggcagggatctaaatcctgttgtggctgttaccaaaactgaagaagatgagaaacat
ttgagaaatccagataggcctacttccttgttagaactccagggtaattgggacgaggac
gaaacttattctagaaaacgtgtgcagagattgtcttctccagaaaagtgggaaattaaa
caaatgcttgccgcatcttgtatcgataggagtgaattgccagaattcgataccgaaacg
ggaatcctcccacgagaagacgatgaagaagaagacgttgaaatagagttagtggaagaa
gagccaccatttttacatggccacggaagagctcttggagacttaagtcctgttcgtata
gtaaaaaatcctgatggttctttagcgcaagctgcaatgatgcagagtgctttagcaaag
gaaaggagggaacaaaaaatgttgcaaagagaacaggaaatggattctgttccaacaggt
ctgaacaaaaattggattgaccctctaccagaagctgaaagtagaacattagctgcgaac
atgcgtggaatcggccttcaaacacaagatttgcccgagtggaagaaacacgtgatagga
ggaaaaaagtcttcctttggaaagaaaacaaatttaactcttcttgaacagcgtcagagc
ttaccaatatataaactcagggatgatttagttaaagctgtgacggataatcaaatttta
atcgtaattggagaaacagggtcaggaaagaccacgcaaattacacagtatttagcagaa
gcagggttcacagcccgtggaaagatcggctgtactcaacctagaagagtggctgccatg
tcagttgccaaaagagtggcggaagaattcggttgtcgtttaggacaagaagttggctac
acgattcgttttgaagactgtactggtccagaaaccaacataaagtatatgactgatggt
atgttgctaagagaatgtctcatggatttggatttgaagacatactctgtaattatgttg
gatgaggcacatgaacgtaccattcacacggacgttctttttggattgctgaaacaagct
gtagggaggaggccagatttaaagctaatcgttacaagtgcaactttggatgctgtcaaa
ttttcacaatacttttttgaagcaccgatcttcactattcctggtagaacattcgaagtt
gaagtcatgtacaccaaagaaccagaaacagactatctggatgccgcactgataacagta
atgcagatacatttgagagaacctccaggagacatacttctattcctaactggtcaagaa
gaaatcgacacagcttgtgaaattttatacgaacgtatgaaatctttaggtcctgatgtt
ccagagttaatcattttgcccgtgtattcggcgcttccttcggagatgcagacgagaata
tttgaaccagctccacctggttccagaaaagtggtaatagccaccaatatagcggaaact
agtttgactatcgatggaatttattacgtagttgatccaggatttgtgaaacagaaggtc
tataattctaaaactggaatggatagtcttatagtaacaccaataagtcaagcagctgcg
aaacaaagagcaggaagggctggcagaactggtccaggaaaatgttatagactttatact
gaaagggcttatagggacgaaatgcttccgacgccggttccagaaatccaacgtactaat
ttagcaaccacggtattacaattaaagactatgggcatcaatgatctattacactttgat
tttatggatgctccacctgtcgaatcgctgattatggctttggaatctctacacagctta
agtgcattagataacgaaggtttgttaaccagattaggaagaaggatggcagagtttcct
ctagaacctaatttatctaaaatgcttattatgagcgtacatcttcaatgctcagatgag
atattgaccatcgtcagcatgttatctgttcagaacgtcttctacagaccgaaagataag
caagctttagcagatcaaaagaaagcaaaattcaaccaaccggagggcgatcatttaact
ctgttggcagtttataactcctggagaaataataaatttagtaatgcatggtgttatgaa
aattttgtgcaaattagaactttaaaacgcgctcaagatgttcggaaacaactattaggt
ataatggacagacacaaattggacgtagtatctgcgggtaaaaacactgtaagaattcag
aaagctgtttgttctggtttcttcagaaacgccgcaaagaaagatcctcaagaaggatat
agaaccttggtagatagccaagttgtctacattcatccaagtagcgcgttatttaacaga
caaccggaatgggtaatttatcatgaattggtccaaactacaaaagaatacatgagggaa
gtgacaactatagatccaaaatggttagtagagtttgcgccagcatttttcaaatttagc
gatccgaccaaacttagcaagtttaagaagaaccaaagattggaaccactttataataag
tacgaagaaccgaacgcttggcgaatatcaagggttcgaagaagacgtaattaa

DBGET integrated database retrieval system