KEGG   Bombus impatiens (common eastern bumble bee): 100742496Help
Entry
100742496         CDS       T04362                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 3-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00071  Fatty acid degradation
bim00410  beta-Alanine metabolism
bim00592  alpha-Linolenic acid metabolism
bim00640  Propanoate metabolism
bim01040  Biosynthesis of unsaturated fatty acids
bim01100  Metabolic pathways
bim01200  Carbon metabolism
bim01212  Fatty acid metabolism
bim04146  Peroxisome
Module
bim_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
bim_M00087  beta-Oxidation
bim_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100742496
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100742496
   00592 alpha-Linolenic acid metabolism
    100742496
   01040 Biosynthesis of unsaturated fatty acids
    100742496
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100742496
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100742496
Enzymes [BR:bim01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     100742496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 100742496
NCBI-ProteinID: XP_003485741
Position
Unknown
AA seq 674 aa AA seqDB search
MKNTIADLPKGPLDPYRKSATFDWKLLKLNIEGEDFVEFQKTLWDFMKKTSVFQRHNCTT
LDEQRRLCNARVRALRDNNIASPLTHAHWFNIVFQYEASIPIKMGVMDGMVPSTILALGN
DDHFQTVAKIQEGEYTCCFALTEISHGTNAKGIRTTATYDAKSKAFILNTPDFEAAKCWI
GGLGKTATHAIVFAQLVTPDQQNHGLHTFIVPIRNPNTHIPYPNIDVGDMGEKIGLNGVD
NGFIMFNNYLISRTCLLNKTADVTEDGNYTASVKDKSKRFGASLGALSSGRITITSICAN
FASVAITIAVRYCTVRKQFGPSELEEWPVIKYQAQQWRLFPHLAATYALKIFSAEFVNQM
CEFNFKLITAKNQDNIDNEGMEIHALSSATKPVCSWTSRDIIQDCRESCGGHGYLKISRL
GDLRAENDVTCTFEGENNVLIQQASNWLLNQWSNVLNGKPINSPLRTADFMKDANSILMQ
TFPYTTVDETLKPENLFLSFTWLLCYYLKRTYEQTQNLKRKGCDDFEIRNNTQVFFAQTL
SLLYGQHVIMKYFIECIQNPSWRSEERNVLIKLCSLYGAAILEKRLGDFYAGGYASPKSN
MDTLLRRGIIILCKELVQEAVALVDVLAPPDFVLNSPLGMSDGQVYKHIKEEIFKVKENF
ERPSWWREIVRSKL
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatacaatagctgacttaccaaaaggccctttagacccttatagaaaatctgca
acatttgattggaaattattgaaacttaatatagaaggagaagattttgttgaatttcag
aaaacattgtgggattttatgaaaaagacatcagtatttcaaagacataactgtactaca
ttagatgaacaacgaaggctttgtaatgctcgtgttcgagcactgagagataataatatt
gcaagtccactaactcatgcacattggtttaatatagtatttcaatatgaagcctctata
ccaataaaaatgggtgtgatggatggtatggtaccaagtacaattcttgcattgggcaat
gatgatcattttcagactgtagcaaaaattcaagagggagaatatacttgttgttttgca
ctgactgagatatcccatggaacaaatgcaaaaggaataagaactacagctacatatgat
gcaaaatcaaaggcttttatcttaaatactcctgatttcgaagctgcaaaatgttggatt
ggcggtttaggaaaaactgcaacgcatgctattgtatttgcacaattagtaacgccagat
caacaaaatcatggtcttcatacttttattgtacccatcagaaatccaaatactcatata
ccttacccaaatatagatgttggtgacatgggtgaaaaaattggattaaatggagttgac
aatggattcataatgtttaacaattatcttatttctcgaacatgtttgttaaataaaaca
gcagatgttactgaagatgggaattatacagcatctgtgaaagataaaagcaaacgattt
ggtgcatccttaggtgcattatcttcggggcgtattaccattacatcaatatgcgcaaac
tttgcatctgttgcaataaccattgctgtgcgatattgtaccgtaagaaaacaattcgga
ccatcggaattagaagaatggccggttataaaatatcaagcgcagcaatggcgattgttt
cctcacttggcagcaacatatgctctaaaaatattttctgctgaatttgtaaatcaaatg
tgcgaatttaatttcaaacttataactgcaaaaaatcaagataatattgataatgaaggt
atggaaatacatgcattatcttctgcaacaaaaccagtatgttcgtggactagtcgagat
attatacaggattgtagagagtcttgcggaggacacggttatcttaaaatctcacgtttg
ggcgacttgagagctgaaaatgatgtaacttgtacatttgaaggcgaaaataatgtatta
attcaacaagccagcaattggttactaaatcaatggtcaaacgtactcaatggaaaacca
ataaattctcctttaagaacagcagatttcatgaaagatgccaacagtattttaatgcaa
actttcccttatacaacagtcgatgaaacattgaaaccagaaaatttatttttatccttt
acgtggttattatgttattatttaaaaagaacatatgaacagacacaaaacttgaaacgc
aaaggttgtgatgatttcgaaattagaaacaatactcaagtattctttgcacaaacatta
tctctattatatgggcagcatgtgataatgaagtacttcatagaatgtattcaaaatcct
tcatggagatcagaagaacgcaatgtgctaataaagttatgttcgctctatggagcagct
attttagaaaaaagattaggagacttttatgctggtggatatgcatcacccaagagtaat
atggatacattattgcgaagagggattataattttgtgtaaagaattagttcaagaggca
gtagcattagtagatgttttagcaccaccagattttgtattaaattctccattaggaatg
tcagatggtcaagtatataaacatatcaaagaagaaatatttaaagtcaaagaaaacttt
gaacgaccgtcatggtggagagaaatagtacgatcaaaattatga

DBGET integrated database retrieval system