KEGG   Bombus impatiens (common eastern bumble bee): 100744038Help
Entry
100744038         CDS       T04362                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog isoform X1
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
bim  Bombus impatiens (common eastern bumble bee)
Brite
KEGG Orthology (KO) [BR:bim00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bim04131]
    100744038
Membrane trafficking [BR:bim04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    100744038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_1 Vps39_2 WD40 zf-RING_5 ANAPC4_WD40 zf-RING_2 zf-C3H2C3
Motif
Other DBs
NCBI-GeneID: 100744038
NCBI-ProteinID: XP_003493982
Position
Unknown
AA seq 843 aa AA seqDB search
MENTSNKEEQNNQNDSDSEVDEVEPRLKYVRVRNDLEHILQNDAASCIAVHPKFLCLGSH
WGMIHLLDHQGNNIQSKSLQAHTVAVNQISIDHNGDFIASCSDDGKVFIYGLYSTENNHN
MSMGRLVKSIAIDPNYYKSCSGRRFITGDDKLVLYEKTFLSRMKLTVLCDAEGGVRSIAW
IGHFVAWASDTGVRIYDLNAKCSLGLIKWTRSTDALPEHYRCNLRWSDDRTLLIGWVDIV
RICQIRKRSIQEMVNRDLPEFVVDPVSTFQVDFYISGIAPLENQLVLLGCLKELDEDGKS
QRPTLHVVEPKYHDFTLVCANSLTLRGYKEYSCNDYHLDCLKEENRFFIVSPKDIVVASL
YDADDRIEWLLSHGKFEQALEAVTLDNGKDCKKYTFVYVGRIYLDHLLACGKYDEAGKLC
SKILGKDKKLWEEEVYKFARVHQLRSISSYLPRGDVTLDPLIYEMVLYEYLKMDPDGFLQ
LVKEWSPKLYKVAAVVNGVLEHLIVDNQRQNVLLEALAILYIHDEKYDKALAMYLKLRHK
DVFQLIKKYHLYNTVYDMIEGLMDLDAERAIQFFLEKDAVPSDIVVQKLQHNHRYLYLYL
DELNKKDTEDKYHGLLVQLYANYSRDKLLPLLRRSNNYPIQQALDICSQRKFYPEMVYLL
GRIGNTSEALALMTRELNDMQSAIAFCQEHDDEELWNDLIIYSLDKPKAITFLLQKIGTY
VDPRLMVQRIEPSLEIPGLKKALVKMMCDYNLQVSVQEGCRKMLSNDYFNLHERLVKCYQ
KGIFIDDDQMCGACHRKIIVREPRNLVVFYCKHSFHEDCLPNFEVVENCVICNSQKDISP
SRK
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatacctcgaataaggaagaacagaataatcagaatgattcagactctgaggta
gatgaggtagaacctagactcaaatacgtcagagtacgaaatgatttagaacatatatta
caaaatgatgcagctagttgcattgcagtacatcctaagttcctatgtctgggttcacac
tggggtatgatacatcttttagatcatcaaggaaataatatacagtctaaaagtttacaa
gcacatacagttgctgtcaatcagatttctatagaccataatggagatttcattgcatcc
tgtagtgatgatggaaaagtttttatatatggtctttacagcacagagaataatcataat
atgagcatgggtagattagttaaaagtatagctatagatccaaattattataaaagttgt
agcggaagaagatttattacaggggatgataaattggttttgtatgagaaaacattttta
tccagaatgaaactaactgtattgtgcgatgcggaaggaggagtaagatcaattgcatgg
attggacattttgtggcttgggcatctgatactggtgtcagaatctatgatttaaatgcc
aaatgttcattaggtctcattaagtggactagatctactgatgcattaccagaacattac
agatgtaatcttcgatggtcagatgatagaacattattaattggttgggttgatatagtg
cgaatttgtcaaattagaaaaaggtcgatacaggaaatggtcaatagagacctaccggaa
tttgtggtagatccagtttcaactttccaagtggacttttatatttccggtattgcacct
ttagaaaatcagttagtattactaggttgcttgaaagaattggatgaagatggaaagagt
cagaggcccacattacatgttgttgaaccaaagtatcatgattttactcttgtgtgtgca
aattcgcttacacttcgtggttataaagaatacagttgtaatgattatcatttagactgt
ttgaaagaggaaaacaggttttttattgtcagtccaaaagatattgttgtagctagttta
tatgatgcggatgacagaattgagtggctattgagtcatggaaaattcgaacaagcatta
gaggcagtaacattagataatggcaaagattgtaagaagtacacttttgtttatgttggc
cgtatatatttagatcatttgttagcttgtggaaaatatgatgaagcaggaaaactctgc
tctaaaattttaggaaaggataaaaaattatgggaggaagaagtatataaatttgcaaga
gttcaccaactgaggtctatttcttcttatctcccaagaggcgatgtcacgttagatcca
ttgatttacgaaatggttctttatgaatatttgaaaatggatcctgatggatttcttcaa
ctagtcaaagaatggtctcctaaattatataaagttgcagctgttgtaaatggtgttttg
gaacatcttatcgttgataatcaacgacaaaatgtactgttagaagctttagcaattcta
tatattcatgatgaaaaatacgacaaagcgttagccatgtatttaaaattgagacataaa
gatgtatttcagcttattaaaaaataccatctgtataataccgtttacgacatgatagaa
ggtttaatggatttagatgcggaacgtgctatacaattttttttagaaaaagatgcagta
ccatctgatatcgttgtacaaaaattgcagcataatcatcgatacttatacttgtattta
gatgaattaaataaaaaagatacagaagataaatatcatggattgttagtccagctttat
gctaattattcaagagataaattgttacctcttctacgccgttctaataattatccaata
caacaagcactagatatctgtagtcagcgaaaattttatccagaaatggtatatctactt
ggtagaattggaaacacttctgaagctttagcacttatgactagagaattaaacgatatg
cagagtgcgattgcattttgtcaagaacacgatgacgaggaactgtggaatgatttgatt
atttattctttggataagcccaaggctattacatttttgttgcaaaaaataggcacatat
gttgatcctagacttatggtacaaagaatagaaccgtctttagaaattcctggtttaaag
aaagctttagttaagatgatgtgtgactacaatctccaagtgtcagtacaagaaggatgt
agaaaaatgttatccaatgattatttcaacttacatgaaaggctagttaaatgttatcaa
aaagggatatttatagatgatgaccaaatgtgtggagcttgccataggaaaataattgta
agagaaccaaggaatctagttgtattttattgtaaacattcgtttcatgaagattgtcta
ccaaatttcgaggtagtggaaaattgtgttatatgtaactcgcaaaaagatatatctcct
agcagaaaatga

DBGET integrated database retrieval system