KEGG   Bombus impatiens (common eastern bumble bee): 100744282Help
Entry
100744282         CDS       T04362                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase isoform X1
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00030  Pentose phosphate pathway
bim00480  Glutathione metabolism
bim01100  Metabolic pathways
bim01200  Carbon metabolism
Module
bim_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bim_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100744282
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100744282
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bim04147]
    100744282
Enzymes [BR:bim01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     100744282
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     100744282
Exosome [BR:bim04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100744282
  Exosomal proteins of colorectal cancer cells
   100744282
  Exosomal proteins of bladder cancer cells
   100744282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 100744282
NCBI-ProteinID: XP_012249858
Position
Unknown
AA seq 521 aa AA seqDB search
MEKVRKMSTEESLRFIRQSLKSDEMDHLEGIHFDRLYPHVFVTLGASGDLARKKIYPTLW
WLFRDNLLPKPTTFVGYARTNLTVDQLREKCHPYMKVKPDEQEKYEEFWKLNHYVAGTYD
SQKGFEALNNELMKYEQNYQITHRLFYLALPPSVFESVTVHIRNVCMSNKGWTRVIIEKP
FGRDTVTSQYLSDHLASLFKEDQIYRIDHYLGKEMVQNLMTLRFGNRVFGPTWNRDNIAS
VQITFKEPFGTQGRGGYFDEFGIIRDVMQNHLLQILSLVAMEKPVSCHPDDIRDEKVKVL
KCIKSLELENVVLGQYVGNPESTDPDARLGYLDDSTVPAGSNTPTFALAVLRINNERWDG
VPFILKCGKALNERKAEVRIQYQDVSGDIFDGKAKRNELVIRVQPGEALYIKMMTKSPGI
AFDMEETELDLTYGYRYKGLKLPDAYERLILDVFCGSQMHFVRNDELSEAWRIFTPLLHR
IENEKIKPVPYSYGSRGPKEADEMAKTNNFNYYGSYKWARH
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtaagaaaaatgtccacggaggaaagcctgcgcttcatcaggcaatcattg
aaatcggatgaaatggatcatcttgagggtatccatttcgatagattgtaccctcacgtg
tttgttaccctcggagcttctggcgatttagcgaggaagaagatctatccaacgctatgg
tggctgttcagagacaatcttttaccaaaacccaccacattcgtgggttacgcgcgcaca
aacctgactgtggatcaattaagagaaaagtgtcatccatacatgaaagtgaaaccagac
gagcaggagaaatacgaggagttttggaaactgaatcactatgtcgctggtacgtacgat
tcacagaaaggatttgaagcgctgaacaatgaactgatgaaatacgaacaaaactatcaa
atcactcacagactgttctacctggccttgcctccgagcgtttttgaaagcgtaaccgta
catattaggaacgtttgtatgagtaacaaaggctggaccagagtgattatagagaaacca
tttggtcgtgacacagttacgtcacagtatctatccgatcacctagcgtcgttatttaaa
gaagatcagatttaccgtatcgaccattatctaggcaaagaaatggttcaaaatctgatg
actctgagatttggtaatcgagtatttggtccaacctggaacagggataacattgcttct
gtacaaattacatttaaagaaccgtttggtacgcaaggaagaggcggctacttcgatgaa
ttcggtatcattagggatgtcatgcagaatcatttgttgcaaatcctatcgttggttgcg
atggagaagccggtgtcttgtcatccagatgacatccgagatgagaaggtaaaagtgctg
aagtgcataaagtctttggagttggagaatgttgtgttaggtcaatacgttggtaatcct
gaatcgactgatcctgatgctcgacttggttatttggatgattcaactgtaccggctggt
tctaacactcccacattcgctctcgccgtgttaagaattaataacgaacgatgggacggt
gttccatttatcctcaagtgtgggaaagcgttaaatgaacgaaaagcagaagttagaata
caatatcaggatgtatctggtgatatattcgatggaaaagcgaagaggaatgaattagta
attagagtacaaccaggtgaagcgttgtatattaaaatgatgacaaagtcgcctggtatc
gcgttcgacatggaggaaacggagttggaccttacgtatggttacaggtacaagggcctg
aaactcccggacgcgtatgaacgattaattttggacgtattttgcggctcgcaaatgcat
tttgtacgtaacgatgaactttcggaagcgtggagaattttcacgcctctgcttcatcga
atagaaaatgaaaagatcaaacctgttccatatagttatggttcacgaggacctaaagaa
gccgatgaaatggcaaagacaaataacttcaactattacggttcttacaaatgggcgaga
cactaa

DBGET integrated database retrieval system