KEGG   Bombus impatiens (common eastern bumble bee): 100745787Help
Entry
100745787         CDS       T04362                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00010  Glycolysis / Gluconeogenesis
bim00562  Inositol phosphate metabolism
bim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100745787
   00562 Inositol phosphate metabolism
    100745787
Enzymes [BR:bim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100745787
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100745787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 100745787
NCBI-ProteinID: XP_003491185
Position
Unknown
AA seq 468 aa AA seqDB search
MNTYVLFLTFLISHVYARDGDSCFADEDDPYLYMATKTAYHFVHAGKTRFQDVPNCHAEQ
IWMFATHGTRCPSETEDIEMQKLTKLRDHIISNHEVQNNGRMCIRDLENLKRWKTDEYLK
IERAEVLTPQGVEDMRLLARRLQSNFPQLLQPFDENITAENYVFKTTDARESSMSYFMEG
LFGDRQAVDAEEVAINDTLLTMYKSCNMWNNGPSNTTIKEVIMFEEGAQFKNLIQNVSQN
LGFLDDISKESVLTMYDMCRYEKAWTVTKLSPWCAVFSKEELRVLEYREDLYYYYKAGYG
REINAQLGCTLLQDMMNHFWRVEQNGESNEPKGIFYFGDIISLQNLLTTLNINKDQTQLT
AFNYKDMAKRRWRTSFMSPFAANLVAVFYRCDITSQPNKVMFYLAEKLVMLDGCDVGLCD
WEYFKQKFNPMLKHCDLNVCWNGSGATTYATNFFLVLLSCFSLVFIRK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatacgtactattcttgactttcttaattagtcacgtttacgcgcgtgacggt
gactcttgttttgcggacgaagatgatccatatttatatatggccactaaaactgcctac
cattttgtccacgccggtaaaactcggtttcaagatgtacccaactgtcatgcagagcaa
atttggatgtttgctacacacggtacacgatgcccgtctgagacagaggatatcgaaatg
caaaaattaacaaaactacgggatcatataattagcaatcacgaagttcaaaacaatggc
cgtatgtgcatcagagatttagaaaatttaaagagatggaaaacggacgagtacctcaaa
atcgaaagagcggaagttttgacaccgcaaggtgtggaagatatgagattgcttgcgaga
cgattgcaaagcaattttccgcagcttcttcaaccattcgacgaaaatataacggcggaa
aattatgtgtttaaaacgaccgatgcacgcgaaagcagcatgagttactttatggaggga
ctgtttggagacagacaagcggtggatgcggaagaagttgccataaatgatactctgctt
acaatgtataaatcctgcaacatgtggaataatggtcctagtaatactaccatcaaagaa
gtaattatgttcgaagaaggagcgcaatttaaaaatctgatacagaatgtcagtcagaat
cttgggtttttggacgatatttccaaagaatcagttctaacgatgtacgatatgtgccgt
tacgaaaaggcctggacagtgacgaaactttctccttggtgtgctgttttcagtaaagaa
gaacttcgtgtgctagagtatcgcgaagatctctactattattacaaggccggatatgga
cgtgaaatcaatgcgcagctaggatgtacccttttgcaagacatgatgaatcacttttgg
agagtggaacaaaatggagagtctaacgaacctaaaggcatattctacttcggcgatatc
ataagtctgcagaacctcttgaccacgttgaatattaataaggatcaaacgcaactgacg
gcttttaattacaaagatatggcgaaacgtcgttggcgaacctctttcatgtcgcccttc
gccgcgaatcttgtcgctgtattttacagatgcgacatcactagtcaaccaaacaaagta
atgttttacttggctgagaaactggtcatgctcgacggatgtgatgttggtctctgcgat
tgggaatattttaagcagaagttcaatccaatgcttaaacattgtgatcttaatgtttgc
tggaacggaagtggtgccaccacttacgctaccaatttcttcctcgtccttctttcatgc
ttctctctagtctttattagaaagtag

DBGET integrated database retrieval system