KEGG   Bombus impatiens (common eastern bumble bee): 100746844Help
Entry
100746844         CDS       T04362                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00450  Selenocompound metabolism
bim00970  Aminoacyl-tRNA biosynthesis
bim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100746844
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100746844
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bim01007]
    100746844
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bim03016]
    100746844
Enzymes [BR:bim01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100746844
Amino acid related enzymes [BR:bim01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100746844
Transfer RNA biogenesis [BR:bim03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100746844
 Prokaryotic type
   Other AARSs
    100746844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 100746844
NCBI-ProteinID: XP_012237119
Position
Unknown
AA seq 645 aa AA seqDB search
MAISSQAIRLPILISMKNVFFCTNNCNKRYIMTTCTKLEKVLERLEKNPFFEKYANKIAK
FQQTSPDEFLQRVENEEKKIQGRKVTVHLSRSCHIQSSWMFPFVMTRTQPWNYVKKRNFS
DHAMKSIYITTPIFYVNAGPHIGHLYTAVLADTIARFNAMLGHSVFLCTGTDEHGMKVQK
AASNVTLPIPEYCTRVSRQFQEMCDVFDVEYSKFIRTTEERHQKAVLDFWNRLEKNGYIY
QGKYSGWYNVSEEAFVPDKDVVKKNPANINEAYTESGDVLEWMEEECYKFRLSSFKNELK
HWLKNANVIEPEIYHTSLIPWIDNLQDLSISRPIKRVSWAIPTPSDESHTVYVWLDALVN
YLTSVGYPDDSFRKFWPPTVQVIGKDILKFHGIYWPAFLMAAGLELPKKLICHGHWTVKD
KKMSKSKENVISPFEAMHNFTQDGLRYFLLRHAVLHTDANYNNLKIQNVLNSELADTLGN
LFNRCFGKSINPDGIIYNSAEYINILKSKIAHKNVVALEELSEKAKEYYEKYNLYCTVDI
VMNMLHIANQMFHHHRPWELSKAKDSDSVKQVEAVISLALENLRVAALVLYPIIPKLASN
LLDVLQVSKSNRTWEDTKPIHLTNASNETRHVLTQNILFFKKIKN
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggcaatttcttcacaagcaatacgactaccaatattaatatctatgaaaaacgttttt
ttttgtacaaacaattgcaataagagatacattatgacaacttgtacaaagcttgaaaaa
gttttagaaagacttgaaaaaaatcctttttttgaaaaatatgctaataaaatagcgaaa
tttcaacaaaccagcccagatgagttcttacagcgtgtcgaaaatgaagaaaagaagatt
caaggaaggaaagttacagtccatctgtcaagatcttgtcatattcagtcttcatggatg
tttccattcgtaatgacaagaacacaaccatggaattatgttaaaaaaaggaattttagt
gatcatgcaatgaaaagcatatatattactacacctatattttatgttaatgctggacca
catataggacatctttatacagcagttttggcagataccatagctagattcaatgctatg
ctaggacattctgtgtttttatgtacaggtacagatgaacatggcatgaaagttcaaaaa
gctgcaagtaatgtgactttacctattcctgaatattgtactcgggtttcacgtcaattt
caagaaatgtgtgatgtgtttgatgttgaatattcaaagtttattagaacaactgaagaa
cgacatcaaaaagcagttcttgacttttggaatcgtttagaaaaaaatggatatatttat
caaggaaaatattctggttggtataatgtatcagaagaagcatttgtcccagataaagat
gtagtaaaaaagaatcctgcaaatattaatgaagcatatacagaatcaggagatgtgtta
gaatggatggaggaagagtgttataaatttcgattgtcttcttttaaaaatgaattaaaa
cattggttgaaaaatgcaaatgtaatagaaccggaaatatatcacacgagcttgattcca
tggatagacaatttacaagacttaagcatttctagacctatcaagagagtgtcttgggca
attcctactccttctgatgaatctcatacagtatatgtatggctggatgcattagtcaat
tatttaacttcagtgggatatccagatgattcatttagaaaattttggccaccaactgta
caagttataggaaaggatatattgaaatttcatggtatatattggccagcatttttaatg
gctgctggtcttgaattaccaaaaaaacttatatgtcatggacattggactgttaaagat
aaaaagatgtcaaaatccaaagaaaatgtaatatcaccttttgaagcaatgcataatttt
acacaagatggtctaagatattttctcttacgacatgcagtgctgcacacagatgcaaat
tataacaatttaaaaattcagaatgtactaaattctgagctagctgatacactaggtaat
ttatttaatcgttgttttggtaaaagtattaatccagacggaataatatataactctgcc
gaatatataaacattttaaaatccaagatagctcataaaaatgtagtagctttggaagaa
ttaagtgaaaaagctaaggaatattatgagaaatataatttgtattgcacagtggatatt
gtgatgaatatgttgcacattgctaatcaaatgtttcaccatcatcggccatgggaatta
agcaaagccaaagattccgattctgtaaaacaagttgaagctgtgatctctttagctttg
gaaaatctacgagtagctgctttagtattgtatcccattataccaaagttagcttctaat
cttcttgatgttcttcaagtttcaaaaagcaatcgtacttgggaagatacaaaaccgatt
cacttaacaaatgcttcgaatgaaacaagacacgttttgacgcagaatatattatttttt
aaaaaaataaaaaattga

DBGET integrated database retrieval system