KEGG   Bombus impatiens (common eastern bumble bee): 100747458Help
Entry
100747458         CDS       T04362                                 

Definition
(RefSeq) dual specificity protein phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim04013  MAPK signaling pathway - fly
bim04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:bim00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    100747458
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    100747458
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bim01009]
    100747458
Enzymes [BR:bim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100747458
    3.1.3.48  protein-tyrosine-phosphatase
     100747458
Protein phosphatases and associated proteins [BR:bim01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    100747458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Y_phosphatase PTPlike_phytase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 100747458
NCBI-ProteinID: XP_024224993
Position
Unknown
AA seq 635 aa AA seqDB search
MSAKISLANRGAAQSPVNHRGKASSGLLLAGKSVKRPSSMTVEVTGTEERVVKRAAVPKV
EGSSSLSRPNTLLKRESTMPALTRGCTTATLPRIKRFKFGSFASSSCLDITTTDVRSTYT
FQQQQQHRQASSLSPXXXXXXXEPVSAGRSRDNLKLVLNRSLSEPGPPASASTFLSSPTS
TVSPSSSTSSGVDSCIASDGTECSLNASGSSISACSSSSSGTDCDLPLSDVHRHYHHLHH
HHHFHQHQLSASKRCKVETVSLPASPCSENNTLQRQLVLQRTKTITADELANRLLGRDPS
GSVLLDCRPFILYNVNHVRGAINVNCSDRFNRRRLQLGKASLADLANTREGKELLRRRHY
REVIVYDDCTDDVDRLPVQHPLFLVLVALLDDNREPALLLGGHKEFHRRHRDLCEDTLLP
TVAAGPSTVAGCSSPGPGCPVLSLSGPPTPQPADIDSHPASRVLPFLYLGNGRDAADLQL
LRALGATRVLNVTSQLPGYHEERGITYRQIPASDSGHQNLKQYFEEAFDFIEEARKAGSS
VLVHCQAGVSRSATIAIAYIMRHKGLSMVEAYKLVKNARPIISPNLNFMGQLLELEQGLR
ASGGVAAAPEEPKSCHQCRWSHQPNSEEVTSGCSV
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaaagatatcccttgcgaatcgtggagcggcgcagtcgccggtcaaccatcgt
ggcaaagcatcgtcggggctgttgctcgccggaaagtctgtcaagaggccgtcgtcgatg
accgtagaggtgactggcaccgaggaaagagttgtcaaacgagccgctgttccgaaagtg
gaaggatcgtccagcttatcacgtccaaatacgctgttgaagagagagagcaccatgcca
gccttgacgcgcggttgcactactgcgacgctgccgaggatcaagagattcaaattcggc
tccttcgcgtccagctcgtgtctcgatataaccacgactgacgtcaggagtacgtacacg
ttccaacaacaacagcagcatcggcaggcatcgtcgctgtcaccnnnnnnnnnnnnnnnn
nnnnnngagccggtctcggccggacgctcccgggacaacctgaagctggttctgaatcgc
agtctgagcgagccaggaccaccagcgagcgcgtctacgttcctgtcctcgccgacgtcc
acggtatcgcccagctcgtcgaccagcagcggtgtcgacagttgcatagccagcgacggt
accgagtgtagtttgaacgccagcggaagtagcatcagcgcctgtagcagctcaagcagc
ggtaccgactgcgacctcccgttatccgacgttcatcgtcactaccatcatcttcatcat
catcaccactttcatcagcaccagctgtccgcgtcgaaacgctgcaaagtggagaccgtc
agcctcccagcgagtccgtgctccgaaaacaacacgctgcagagacagctggtactccag
aggactaagaccatcaccgccgatgaactggcgaatcgtctcctcggacgggatcccagt
ggttcggtgttgctcgattgccgaccgtttattttgtacaacgtgaaccacgtaaggggc
gccatcaatgtgaattgctcggatcgattcaaccggagaaggttgcaattgggtaaagcg
agtctggccgatttggcgaacaccagagaaggcaaagaactgttgcgtagaaggcactac
agggaggtgatcgtttacgacgattgtaccgacgatgtggatcgactacccgttcagcat
ccgctgttcctcgtactcgttgcgttgctggacgataacagagagcccgctcttcttttg
ggtggacacaaggagttccataggcggcacagggatctctgcgaggacacgcttctacca
accgtcgcagctggcccatcaacggtcgccggttgttccagtccaggaccaggctgtccg
gtattaagtctatccggaccaccgactccccaaccggcggatatcgatagtcatccagcc
tccagggttctcccgttcctctaccttggaaatggccgagatgcagccgatttacagctc
cttcgcgcgttaggcgccaccagggtgctcaatgtcacttcacagctacctggatatcac
gaggagaggggtatcacgtacagacaaatccctgcctcggattctggccatcagaacctt
aaacagtacttcgaggaggcgttcgacttcatcgaggaagcccggaaagccggaagcagc
gtgttagtgcactgtcaagcgggagtgtcgcgcagtgctacgatcgccatcgcgtacata
atgcggcacaagggtttgtctatggtggaggcgtacaagcttgtgaagaatgcgcgacct
atcattagccctaatctgaactttatgggacaattgttggagctcgaacagggtttaagg
gcgtccggtggggtggctgcagccccggaagaaccgaagagttgtcaccagtgtcgttgg
tctcatcaaccgaacagcgaagaagttacttccggttgcagcgtttga

DBGET integrated database retrieval system