KEGG   Bombus impatiens (common eastern bumble bee): 100747571Help
Entry
100747571         CDS       T04362                                 

Definition
(RefSeq) adenosine kinase 1 isoform X1
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00230  Purine metabolism
bim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100747571
Enzymes [BR:bim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     100747571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 100747571
NCBI-ProteinID: XP_003491199
Position
Unknown
AA seq 345 aa AA seqDB search
MAVHLREGLLLGVGNPLLDISATVDRNFLEKYDLKSNDAILAEEKHKPMYDELVELYNAN
FIAGGSVQNTMRVAQWFLEKPRVASYMGCVGIDKYSKILEDKARADGLNVRYQYTKKEPT
GTCAVLITGNERSLCANLAAATCFSSSHIEESENKKIIEMAEYIYISGFFLTVSPETILM
IAQHALEKNKMFIMNLSAPFLCEYYKKPMLEALPYVDILFGNEAEADTFAKANDFKTTDR
KEIALKLSQMEKLNKKRQRIVIITQGPDNILVVKDNTIIEIPATKLPNDKVVDTNGAGDA
FVGGFLAQLVQGKSIEVCIKCGIWAATQIVQRSGCTYEGKPDFIP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcacttacgggagggcctcctattaggcgtgggtaatcctcttcttgatatt
tcagcgactgtagataggaattttttggaaaaatatgatttaaaatcgaacgatgcaatt
cttgctgaagaaaaacacaagccaatgtatgatgaattagttgaattgtataatgcaaat
tttatcgccggtggttctgtacaaaatactatgcgagtagcacaatggttcctggagaaa
ccacgagttgcatcttacatgggttgcgttggaatagataagtattccaaaattctggag
gataaagcacgtgcagatggcttaaatgttcgttatcaatatacaaagaaagaacctact
ggtacctgtgctgttcttattactggtaatgaacgttccttatgtgctaatttggctgca
gccacttgtttttcatcttcgcacatagaagaatctgaaaataaaaaaattatagaaatg
gcagaatacatttatatttctggctttttcttaactgtaagcccagaaacaatcctgatg
attgctcaacatgctttagaaaagaataaaatgttcataatgaatctgagtgcaccattt
ttatgcgaatattataaaaaaccaatgttggaggctcttccttatgtagatattttattt
ggtaatgaggcagaagctgatacatttgcaaaagcaaatgattttaaaactacggatagg
aaagaaattgcattgaaattgtcacaaatggaaaaactgaataagaaaagacaaagaatt
gttataataacacaaggtcccgataatatattagtagttaaagataacaccataattgag
attcctgctacaaaacttccgaatgataaggttgtggatactaatggagctggtgatgca
tttgtaggaggttttttggctcaacttgtgcaaggtaaaagcatagaagtttgtataaaa
tgtggaatttgggctgcaactcaaattgtacaaagatctggatgtacttacgaagggaaa
cctgattttattccttaa

DBGET integrated database retrieval system