KEGG   Bombus impatiens (common eastern bumble bee): 100747945Help
Entry
100747945         CDS       T04362                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial-like isoform X1
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00020  Citrate cycle (TCA cycle)
bim00640  Propanoate metabolism
bim01100  Metabolic pathways
bim01200  Carbon metabolism
Module
bim_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bim_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100747945
   00640 Propanoate metabolism
    100747945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bim04147]
    100747945
Enzymes [BR:bim01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     100747945
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     100747945
Exosome [BR:bim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100747945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 100747945
NCBI-ProteinID: XP_012247342
Position
Unknown
AA seq 479 aa AA seqDB search
MSIRLSSFTSFCVRKIGRQVTVFILSSHIQQMQIYQRKYFQFLNRTSVTVQQTRHLQVHE
HIAYTLLKNSGIPTPPFGVAKTPDEAAKIAADLKTKDIVLKAQVLAGGRGMGHFKDTNVS
GVVMCETPEQAKTLTNNMIGKLLITKQTGEAGRICNSVMVTTRMFPRKEYYMAVMLEQSF
DGPVVIVSKQGGVNIEDIAATNPEAISYTPVNIMKGLSLEQINQVVDNLGIEGEERKITS
LIICNLYELFIEKDALLLEINPFALDICGEYFALDCKCSFDDSSEFRQKELFALQDFTQL
DPNEVQASKFNLSYIALDGNIGCMVNGAGLAMATMDLIKYNGGMPANFLDVGGSATEEAV
MEAFKIIISDPKVEAIFVNIFGGIMRCDIIAKGIINASKELQLNIPVVVRLQGTNVEEAH
RLIREAQLKVISVDDFAQAAESVVKLSLIIKAANSMNLDISFTSKETSAEKSKVGSKKK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtccattagactctcgtcttttacatcattttgtgttagaaaaataggaagacaggta
acagtatttattttaagtagtcacatacaacaaatgcaaatatatcaaagaaaatatttt
cagtttttaaatcgtacttctgtcactgttcaacaaactcgacatttacaagttcatgaa
catatcgcatatactttattgaaaaatagtggaattccaactccaccttttggagtagcc
aaaactccagacgaggctgccaagatagcagctgatcttaagacaaaagatattgttctg
aaagctcaagttcttgctggtggacgtggaatggggcactttaaagataccaacgtcagc
ggtgtagttatgtgtgaaacgcctgaacaagcaaagactttgactaataatatgataggt
aaattgttaataactaaacaaactggagaagctggtagaatttgtaattcagtaatggta
acaacacgtatgttcccacgtaaagaatattatatggcagtaatgttggaacaatctttt
gatggtcctgttgtaattgtatctaaacagggcggtgtaaatatcgaagacatcgctgcc
acgaatccggaagctatatcgtatacaccagtgaatatcatgaaaggtttatcacttgaa
caaataaatcaagttgtggataacttaggtatagaaggagaggagaggaagattacatcg
ttaattatttgtaatctctacgagttgttcatcgagaaagatgcattattacttgaaatt
aatccatttgcattagatatttgcggagaatattttgccttagattgtaaatgttctttt
gacgacagttcagagttcagacaaaaggaactatttgcactgcaagatttcacacaacta
gatcctaacgaagtccaagcatctaagtttaatttaagctatatagctttagatggaaat
atagggtgtatggtaaatggtgctggattagcgatggctactatggatttaataaaatac
aatggcggtatgccagctaattttttagatgtgggtggtagtgccactgaagaagctgtg
atggaagcttttaaaataataatttctgatccgaaggtagaagcaattttcgtaaatata
tttggtggtattatgaggtgtgatataatcgcaaaaggtattatcaatgcgtccaaagag
ttacagttgaatattcccgtagttgtaagactgcagggaactaacgtagaagaagctcat
cgattgatacgggaagcacaattgaaagttatttccgtagatgattttgcccaagctgct
gaatcggttgtaaaattatctttaataataaaagctgcaaattctatgaacttggacatt
tctttcacatccaaagaaacatcggcagaaaagtctaaagtcggaagcaagaagaagtaa

DBGET integrated database retrieval system