KEGG   Bombus impatiens (common eastern bumble bee): 100748115Help
Entry
100748115         CDS       T04362                                 

Definition
(RefSeq) dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00790  Folate biosynthesis
bim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100748115
Enzymes [BR:bim01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     100748115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase
Motif
Other DBs
NCBI-GeneID: 100748115
NCBI-ProteinID: XP_003484783
Position
Unknown
AA seq 237 aa AA seqDB search
MEAIIGRVFIYGGKGALGSTCVSKFKSKKWWVGCIDMKANDQADANVIVKPNSNWQEQEV
DIMQQIGNILNGNKLDAIICVAGGWAGGNAANKDFIKNSELMWKQSVYSSSIAASIAAHH
LKEGGFLSLTGAKAALAETPGMIGYGMAKAAVHQLTKSLAAKDSGLPKNSLVVSILPVTL
DTPMNRKWMPNADTTKWTPLEFVADLFWKWSQNQERPANGSLLQLITNDNKTELITA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaataatcggacgggtttttatatatggtggcaaaggtgctttaggttctact
tgcgtttcaaaattcaagtcgaaaaagtggtgggttggctgtattgatatgaaggcaaat
gaccaagctgatgcaaatgtgattgtaaaaccaaacagcaattggcaagagcaggaagtt
gatattatgcaacaaattggaaatattttaaatgggaataaactagatgcaattatttgt
gtggctggtggatgggctggtggaaatgcagccaataaagattttattaaaaacagtgaa
cttatgtggaagcagagtgtgtacagttcaagtattgctgctagtattgctgcccatcat
ttgaaagaaggaggatttttatcattaactggtgctaaagcagctttagcagaaacaccg
ggaatgattggatatggaatggctaaagctgctgttcatcaacttactaaatctttagca
gctaaagatagcggtcttccaaagaattctttggttgtttctatcttgcctgttacttta
gatacacctatgaatagaaaatggatgccaaatgctgatacaactaaatggactccactt
gaatttgttgcagacctcttctggaaatggtcacaaaatcaagaacgtccagctaatgga
agtctcctacaattgattaccaatgataataaaacagaattaattacagcttaa

DBGET integrated database retrieval system