KEGG   Bombus impatiens (common eastern bumble bee): 100749125Help
Entry
100749125         CDS       T04362                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00450  Selenocompound metabolism
bim00970  Aminoacyl-tRNA biosynthesis
bim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100749125
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100749125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bim01007]
    100749125
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bim03016]
    100749125
Enzymes [BR:bim01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100749125
Amino acid related enzymes [BR:bim01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100749125
Transfer RNA biogenesis [BR:bim03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100749125
 Prokaryotic type
   Other AARSs
    100749125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS GST_N_5 tRNA-synt_1 Anticodon_1 GST_C_2 Fez1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 100749125
NCBI-ProteinID: XP_012242290
Position
Unknown
AA seq 964 aa AA seqDB search
MKMNISTNEGNPNTLKLIIAAKVAQHAVTVKTVQPKVGFLSRLPSIELSSGLVLFSTNAA
MQLIVPSSSQESKLLNNKWLEWEISRLQPAIAFYGNTGIYKTTQKSCLWSLLRELNNALE
DKQYLIKDNNDLSLADICIWVTLWSTVMVTEIGNELNKEYLSIKNWISSIELLPVIQDSI
EEYKFERGSKAIFSIQAVSWFPVNTNSNPKPPKPADLQLSPTKEKEMEAVNQEEIQNISS
NWSSKSYPDVKNFPYPVLPKKGEKNILITSALPYVNNVPHLGNIIGCVLSADIFARYCRQ
RNYNTLFISGTDEYGTATEAKALEEKTTPQNICDKFFDIHNDVYRWFNIGFDYFGRTTTP
EQTEIVQSFFLKIKSEGYVLSETVDQLLCESCDRFLADRFVEGTCPRCKYEDARGDQCDG
CGHLVNATDLISPRCKVCSNRPIVKKSQQFFLDLPKLENKLKEWSSTVEKGWSSVAKVVA
KPWLRDGLKPRCITRDLKWGIPVPIKGFENKVFYVWFDAPFGYISITKRYTKEYQQWWKP
TDVQVDLYQFMAKDNVPFHAIMFPAYLLAANEGYTLMKHLMATEYLNYEDTKFSKSRGIG
VFGTDARDTGIPADVWRFYLAYVRPETQDSNFNWVDLATKNNSELLNNFGNFVNRALVFA
EKYFDSKIPPIELQEDDLILLALAQRELSSYIHALEQAKLRDGLKNVLAISKHGNQYMQF
QEPWVKIKGTDNDKKRAGTIIGICCNLACLLSALLAPFMPCTARELRSQLGLQTNNYGYI
PDVITSILPTGHKISKPSPLFKKIEDKDVEILRRKYAGKQETTSSSSGDVKSLDSAITEL
DNKVKKLKAKFDKSGWPSSQIQIFSALKKKLPDLINEKNKSPESKSKKPETVSVPEQNGD
VAIDVASLEAAIAKQGDLVRQLKAKEERSVWQPEVEKLLKLKKQLGDLTGTAAAPTDKKS
KKKK
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaatatttcaacgaacgagggcaatccgaatactttaaagttaataattgca
gctaaagtagcacaacatgctgttaccgtaaaaacggtacagccaaaagttggctttttg
agccgtttaccttctattgaactttcatctgggttagtactatttagtactaatgcagca
atgcagctcatagtaccttcttcatctcaagagtcaaaactccttaataataaatggttg
gaatgggaaatatctcggttacagccagctatagcattttatggtaatacaggaatttac
aaaaccacacaaaagtcatgtttatggtccttattaagagaacttaataatgcgttagaa
gacaaacagtacttaattaaggataataatgacttatcattggcagatatatgtatttgg
gtaactctatggtctacagtaatggtcacagaaattggaaatgaattaaataaagaatat
ttatcaattaaaaattggatatccagtattgaattgctgccagttatacaggattccatt
gaagaatacaaatttgaaaggggctcaaaagcaattttcagtattcaagctgtatcttgg
tttcctgttaatactaattcaaatcctaaacctcctaaaccagctgatttgcagcttagt
ccaactaaagaaaaagaaatggaagcagttaatcaggaagaaatacaaaatatttcaagc
aattggtcttctaaatcatatcctgatgtaaaaaactttccttatcctgtattgccaaaa
aaaggagaaaaaaatattttaataacatcagcattaccttatgtcaacaatgttcctcat
ttaggaaatattattggttgtgttctttctgctgatatttttgcccgatattgcagacaa
agaaactataataccctttttattagtggtactgacgaatatggtactgctacagaagct
aaagctttggaagagaaaacgacaccccaaaatatttgtgataaattttttgacatacat
aatgatgtttatcgatggtttaatattgggtttgactattttggtcgtactactacacca
gaacaaacagaaattgtacaatcatttttcttaaaaattaaatcagaaggatatgtatta
agtgaaactgtagatcagcttctgtgcgagtcctgtgataggttcttggccgatagattt
gtagaaggaacttgtccaaggtgtaaatatgaagatgcacgtggcgatcagtgtgatgga
tgcggtcatttggtgaatgcaacggatcttatatctccgcgatgtaaagtatgtagtaat
agacctattgttaaaaagtcgcaacaattcttcttagatttaccgaagttagaaaacaag
ttaaaagagtggtcctcaacagtagaaaagggatggtcaagcgttgcaaaagtggttgca
aaaccgtggctacgtgatggacttaaaccacgatgtataacaagagatttaaaatgggga
atacctgttccaataaaaggttttgaaaataaagtattttacgtttggttcgacgctcct
tttggttatatcagtattacaaaaagatatacgaaggaataccaacaatggtggaagcct
acagatgtacaagttgatctataccaatttatggcaaaggacaatgttccatttcacgca
attatgttccctgcttatttattagcagctaatgaaggttatacattgatgaagcattta
atggcaacagaatacctcaattatgaagatacaaagttttctaaatcgagaggtatcgga
gtatttggaactgatgctagggatacaggtataccggctgatgtttggcgattttatctt
gcatatgttagacccgaaacgcaagattcgaattttaattgggtggatttagcgactaaa
aataatagtgaattattaaacaattttggaaattttgttaatagggctctagtatttgcg
gaaaaatactttgattctaagataccgccgatagaacttcaggaagatgacttaatatta
ctggcattagctcagcgtgaattatcatcttatatacatgctttggaacaagctaaatta
cgtgatggtttgaaaaacgttttagcaatttcaaaacatggaaatcaatacatgcaattc
caagagccatgggtgaaaattaaaggaacagataatgataaaaaaagagctggaacgatc
atcggtatttgctgtaacttggcatgtcttttatcagcccttttggctccattcatgcca
tgcaccgcccgcgaattaagatcccagttaggattgcaaaccaataactatggctatata
cctgacgttatcacaagcatacttcccacgggacataaaattagtaaaccatctccgcta
tttaaaaaaatagaggataaagatgtagaaatattaagaagaaagtatgctggtaagcaa
gaaactacaagtagcagtagcggagatgtaaaatcattggatagtgcaattacagaattg
gacaataaagttaaaaaactaaaggccaagttcgataaaagtggatggccatccagtcaa
attcaaattttctcagctttgaaaaaaaagctgcctgatctcataaatgaaaaaaataaa
tcccctgaatcgaaaagtaaaaaacctgaaacggtttcggtacctgaacaaaatggagat
gttgcaatagacgtagcaagtttggaagcggccatcgctaaacagggcgatcttgtacgt
caattgaaagctaaagaagaaagatctgtatggcaaccagaagtagaaaaattattgaaa
ctcaaaaaacaattaggagatctcactggaacagctgcagctccgactgacaaaaaatcg
aagaaaaagaaataa

DBGET integrated database retrieval system