KEGG   Bombus impatiens (common eastern bumble bee): 100749467Help
Entry
100749467         CDS       T04362                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CWC27 homolog
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Brite
KEGG Orthology (KO) [BR:bim00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bim03041]
    100749467
   03110 Chaperones and folding catalysts [BR:bim03110]
    100749467
Enzymes [BR:bim01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100749467
Spliceosome [BR:bim03041]
 Complex C
  Other components
   PPlases
    100749467
Chaperones and folding catalysts [BR:bim03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    100749467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase PAP_RNA-bind
Motif
Other DBs
NCBI-GeneID: 100749467
NCBI-ProteinID: XP_012249790
Position
Unknown
AA seq 508 aa AA seqDB search
MSNIYIQEPPTKGKVMMKTTVGDIDLELWAKETPKACRNFIQLCMEGYYDNTIFHRIIKG
FIAQGGDPTGTGEGGESIYGQPFKDEFHTRLRFCRRGLIAMANAGKDDNGSQFFFTLGST
PELQNKHTIFGKVTGETIFNMLKLEEALVDEDDRPLYPPKIIKTQILKNPFSDIVPRIVS
KKNEEINDSLKTKRTGVKNFNLLSFGEEAEEDEEESVILNKQFSSKGKSAHDHLTDPKLS
AQPAIELAGPPNKKIKNDHSSDWESDVEEKTQEELEVIKKEKEAMKERIKNKLRDTKKNS
KTENYKVDDDEDDKEIKEDKYYLGKDRDEERKRKAEEIRKQIRDFKRDVQNEKKAKEADQ
KLRQDQVEKEVKKTEIMKEYIETQEKYKEAKSKLPKKGKSREDFTMELLNKFKSKLQTAK
ETIRERSPSPLKKEDNKEDDFDPADESWMIHALHCEEKAPVLAKDASTKDDDWFEIYDPR
NPLNKRRRGERSHKSNDDKNRQSDSRRK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatttatatacaagaaccacccactaagggaaaagtgatgatgaaaactact
gttggtgacattgatttagagttatgggcaaaagagactccaaaagcatgtagaaatttt
atacaattatgtatggaaggctattatgataacaccatatttcatagaatcattaaagga
tttatagcacagggtggtgatccaacaggtacaggagaaggtggtgaaagcatatatgga
cagccatttaaagatgaatttcacacaagattacggttttgtcgaagaggtttaattgct
atggctaatgctggaaaagatgacaacggttctcagttcttttttactcttggttccaca
ccagagttgcaaaataagcatactatctttggtaaggttactggagaaactatatttaac
atgcttaaacttgaagaagcgcttgtagatgaggatgatagaccactttatcctccaaaa
attataaaaacacaaatattgaagaatccattttctgatattgtaccaaggatagtatca
aagaaaaatgaagaaataaatgatagtttaaaaactaaaagaacaggagtaaaaaatttt
aatcttttatcctttggtgaagaagcagaggaagatgaagaagaatctgtgatacttaat
aaacagtttagtagtaaaggcaagtctgcacatgatcacctaactgatccaaaattaagt
gcacaaccagctattgaattggctggacctccaaacaaaaaaataaaaaacgaccatagt
agcgattgggaaagcgatgtggaagaaaaaactcaagaggaattagaagttataaaaaaa
gaaaaggaagcaatgaaagaaagaataaaaaataaattaagagatacaaagaaaaattct
aaaacagaaaattataaggtagatgatgatgaagatgataaagagataaaggaagataaa
tattatcttgggaaggacagagatgaagaacgtaaaagaaaagcggaagaaattaggaaa
caaattcgggattttaaacgtgatgttcaaaatgaaaagaaagcgaaagaagcagatcaa
aaactaagacaagatcaggtggaaaaagaagtaaagaaaactgagattatgaaagaatat
atagaaactcaagagaagtataaagaagcaaagtcgaaattacctaaaaaggggaaaagt
cgcgaggacttcacaatggagttattaaacaagtttaaatctaaacttcaaactgctaag
gaaactataagagaaagatcgccgagtccattaaaaaaagaagataacaaagaggatgat
tttgatccagctgatgagtcttggatgatacatgcattacattgtgaagaaaaagcacct
gttcttgccaaagatgcaagtacaaaagacgatgattggtttgaaatttatgatcctcga
aatcctcttaataagcgacgaagaggagaaagatcacataaatcaaatgatgataaaaat
aggcaatccgattctcgtcgcaaataa

DBGET integrated database retrieval system