KEGG   Bombus impatiens (common eastern bumble bee): 105681627Help
Entry
105681627         CDS       T04362                                 

Definition
(RefSeq) N6-adenosine-methyltransferase catalytic subunit
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Brite
KEGG Orthology (KO) [BR:bim00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bim03019]
    105681627
Enzymes [BR:bim01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     105681627
Messenger RNA biogenesis [BR:bim03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     105681627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 105681627
NCBI-ProteinID: XP_012247962
Position
Unknown
AA seq 563 aa AA seqDB search
MSDAFEEIQAIKIKRNSLREKLQKRKRERHELFTLTSTTPVSSSLTNESPLSNDSMGHSH
RSDHSEYERDVLCILHESLPNLPITSAELIDLLRKNLNADVSSPDIHKILEKLAAQDIVK
IKEVTENGVFGYTVLSVAESQSSYQSQSDDTENPESAETSASELNDYVPAEKQPKLDKKN
TEDIMSLISMPTIREKENKKVGEQILDLLSKQTSKEKSLAERFRSQGGAQVMEFCPHGTR
VDCVKLNGGPGFAEKCKKLHFKKIIQSHTDESLGDCSFLNTCFHMDTCKYVHYEVDGPTT
QQKESNETDNANNSAVNKGLTVDSKNGSSTACPPPSGSLGSELTLYPPQWIQCDLRYLDM
TVLGKFAVIMADPPWDIHMELPYGTMSDDEMRQLGIPALQDEGLLFLWVTGRAMELGREC
LQLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGMKGNPRINRGLDSDVIV
AEVRATSHKPDEIYGIIERMSPGTRKIELFGRPHNVQPNWITLGNQVDGVHLIDPQLIKA
FKKRYPDGNSMKPSKPLKLECDL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgcttttgaagagatacaggcaattaaaataaaaagaaacagtctacgagag
aaattgcagaaaagaaaacgcgagagacatgaattatttactcttacttctacaacacca
gtatcatcctccttgacaaatgaatcacctctttctaatgattcaatgggacattcacat
cgatccgaccacagtgaatatgaaagagacgtgttatgtattctacatgaatcattacct
aatttaccaattacatctgcagaactaatagatttacttcgtaaaaatcttaatgcagat
gtatcatctccagatattcacaaaattttggaaaagcttgcagctcaagatattgttaaa
atcaaggaagtaacggaaaatggtgtttttggatatacagtattgtcagtggcagaatca
caatcatcatatcagtctcaatcagatgacacagaaaatccagagagtgcagaaacatct
gcatctgaattgaatgactatgtacctgcagagaaacaacccaaattagataagaaaaat
acagaggatataatgtcacttatatcaatgcctactattagagaaaaagaaaataagaag
gttggagaacaaattttagatttgttatcaaagcaaacatctaaggagaaatcactagct
gaaagatttcggtctcaaggaggagcacaagttatggagttttgtcctcatggtacaaga
gtagattgtgtcaagttaaatggtggaccaggatttgcagaaaagtgtaaaaaacttcat
ttcaaaaaaattattcaaagtcacacagatgaatctttaggtgactgtagttttcttaat
acttgctttcatatggatacatgcaaatatgttcattacgaagtggatgggccaacaact
caacaaaaggagtcaaacgaaacagacaatgcaaataatagtgcagtgaataaaggttta
acagtagatagtaaaaatggtagtagtactgcatgtccacctcctagcggatcattaggt
agtgaattgactctttatccaccacagtggatacaatgtgatttacgttatcttgatatg
actgtcctgggtaaatttgctgttataatggctgaccctccatgggacatacatatggaa
ttaccatatggtaccatgtcagatgatgaaatgagacaattaggtatacctgctcttcaa
gatgaaggtctcctatttttatgggtaacagggagagcaatggaacttggtagagagtgc
ctacaattgtggggatacgaaagagtagatgagatcatatgggtgaagactaaccaatta
caaaggataataagaactggcagaacaggtcactggctaaaccatggcaaagaacattgc
ttagtcggcatgaaaggaaatccgagaattaatcgtggtttggatagcgatgttatagta
gccgaagttcgtgcaaccagtcacaaacctgacgaaatctatggaatcatcgaacgtatg
agcccaggaacaagaaaaatagaattatttggtcgaccacataatgttcaacctaattgg
atcacattaggcaatcaagtagatggagttcacttgattgatccacaacttattaaagcc
tttaaaaagcgttatccagatggaaattcaatgaaacctagcaaaccattgaaactggaa
tgtgatctttaa

DBGET integrated database retrieval system