KEGG   Brachyspira intermedia: Bint_1095Help
Entry
Bint_1095         CDS       T01847                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bip  Brachyspira intermedia
Pathway
bip00230  Purine metabolism
bip01100  Metabolic pathways
Module
bip_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bip00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bint_1095 (gmk)
Enzymes [BR:bip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Bint_1095 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 ATPase_2 AAA_22 DNA_pol_B_3 AAA_14 Roc AAA_33 MMR_HSR1 EFP TsaE MobB Tfb5 AAA_16 NTPase_1 cobW
Motif
Other DBs
NCBI-ProteinID: AEM21718
UniProt: G0EMN0
Position
1232965..1233516
Genome map
AA seq 183 aa AA seqDB search
MSNIVVITAPSAAGKTTLIKKYMANHSNAVFSVSYTTRPKRANEVDGQDYYFVDKEKFEQ
MINDGDFIEWASVHDNYYGTSFKELEKADDEDKILILDIDIQGALYIKSKGIDANYIFIT
PPSMEILKKRLEDRGTETEESIKLRIWDAKRELEYKDKFDIIIENDDVEEAYKKLEEAIN
SKL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatattgttgttattacagccccttcggcagccggcaaaactactttaataaaa
aagtatatggcgaatcattctaatgcagtttttagtgtttcttataccactagacctaaa
agagcaaatgaagtagacggtcaggattattattttgtagataaagaaaaatttgaacag
atgataaatgatggcgatttcatagaatgggcatcagttcatgataattattatggaact
tcattcaaagaattagaaaaagctgatgatgaagataaaatattgatacttgatatagat
attcaaggtgcattatatataaaaagcaagggaatagatgctaattatatattcataacc
cctccttctatggaaattcttaaaaaaaggttggaagatagaggaactgaaactgaagaa
agcataaaactcagaatttgggatgctaaaagagaattagaatataaagataaattcgat
atcattatagaaaatgatgatgttgaagaagcttataaaaaattagaagaagcaatcaat
tcaaaattataa

DBGET integrated database retrieval system