KEGG   Brachyspira intermedia: Bint_1393Help
Entry
Bint_1393         CDS       T01847                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bip  Brachyspira intermedia
Pathway
bip00010  Glycolysis / Gluconeogenesis
bip00052  Galactose metabolism
bip00500  Starch and sucrose metabolism
bip00520  Amino sugar and nucleotide sugar metabolism
bip00521  Streptomycin biosynthesis
bip01100  Metabolic pathways
bip01110  Biosynthesis of secondary metabolites
bip01120  Microbial metabolism in diverse environments
bip01130  Biosynthesis of antibiotics
bip01200  Carbon metabolism
Module
bip_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bip00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bint_1393
   00052 Galactose metabolism
    Bint_1393
   00500 Starch and sucrose metabolism
    Bint_1393
   00520 Amino sugar and nucleotide sugar metabolism
    Bint_1393
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bint_1393
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bint_1393
Enzymes [BR:bip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bint_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEM22012
UniProt: G0EPV2
Position
1570033..1570989
Genome map
AA seq 318 aa AA seqDB search
MKEVVIAIDIGGTSMKGAVIEENGNILYKDNFDINPSHTTEEHKKVITEFVEKLKSNIPN
DYKPVGLGIDCPGVMNRETVHMGGAENIPGLKGLKFSDIGDKFNLPTKTANDASMAALGE
AKYGSGKEKDYQSVMFVTLGTGVGGGFVLNGKLFTGSLGGAGEIGHVFVVPDGDKCNCGS
SGCIERYASATGFIAMAKQKIHKGVIPTTLTYEELDKGKAKALFDAAKKGDALAKETIAE
CSYYLGMSIAQALNMLDLDLVLIGGGLCKDFDMMIEHINRGVRNYGLRMMVANLEIKPAS
LGNDAGVLGCAALFFRNN
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttatagctatagatattggcggaacatctatgaaaggtgctgttata
gaggaaaacggcaatattttatataaagataattttgatataaaccctagtcatacaaca
gaagaacataaaaaagttattacagaatttgttgagaaattaaaaagcaatatacctaat
gattataaacctgtaggtttaggaatagactgtccgggagttatgaatagagaaacagtt
catatgggaggagctgaaaatataccggggcttaaaggattaaaattttctgatataggt
gataaatttaatttacctacaaagacagctaatgatgcaagtatggctgctttaggcgag
gcaaaatatggaagcggtaaagaaaaggattatcagtctgtaatgtttgttacacttgga
acaggtgttggaggcggatttgtacttaatggaaaattatttactggttctttaggcgga
gcaggagagatcggacatgtatttgtagttcctgatggtgataaatgtaattgcggatca
agcggctgtattgaacgttatgcttctgctactggcttcattgctatggctaagcagaaa
attcataaaggggttattcctactactttaacttatgaagaattagataaaggaaaggct
aaggctttatttgatgctgccaaaaaaggcgatgcactagctaaagaaactattgcagaa
tgttcttattatttgggtatgtctatagctcaggctttgaatatgcttgatttggacttg
gttcttataggtggcggactttgtaaggactttgatatgatgatagagcatattaataga
ggcgtgagaaattatggtcttagaatgatggttgccaatcttgaaataaaacctgcttct
ttaggaaatgatgccggtgttttaggatgtgccgctttattctttagaaataattga

DBGET integrated database retrieval system