KEGG   Brachyspira intermedia: Bint_1824Help
Entry
Bint_1824         CDS       T01847                                 

Definition
(GenBank) L-fucose isomerase
  KO
K01818  L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
bip  Brachyspira intermedia
Pathway
bip00051  Fructose and mannose metabolism
bip01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bip00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Bint_1824
Enzymes [BR:bip01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     Bint_1824
    5.3.1.25  L-fucose isomerase
     Bint_1824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fucose_iso_N2 Fucose_iso_N1 Fucose_iso_C
Motif
Other DBs
NCBI-ProteinID: AEM22440
UniProt: G0EJP4
Position
2086451..2088232
Genome map
AA seq 593 aa AA seqDB search
MFRMQNNLPKVGIRPVIDGRRNGVRESLEDTTMNMAKIAAKLIEENIKHPSGEKVECVIS
DTTIGGVAEAARCQKKFDENNVKLTLTVTPCWCYGSETIDMTPAIPKAIWGFNGTERPGA
VYLAAADAGHTQLGLPVFSIYGKDVQDAGDENVPDDVKEKILRFVRAGLAVATMKDQSYI
SMGYVAMGIMGSMVDAEFLLDYLGMRTEFVDMSEIKRRLELEIYDKEEFKKAWEWAKQCK
FGADNNKVKASDEEKEKEWATSIKMAMIMRDLMVGNPKLAEMGYIEEAQGHNAIVGGFQG
QRHWTDYMPNGDFAEAILNSSFDWNGIREPYVVATENDSLNGLSMLFAHLLTCKSQLFAD
VRTYWSPEAVKRVTGKELTGKAKDGIIHLINSGAASLDWTGEEKVNGNPALKEFWNITEE
EAKKCLDATQFSPANREYFRGGGFSSTFLTKGEMPMTIIRLNLVKGYGPVLQVAEGYAVN
IDDSIFDPINKRTDSTWPTTWFAPILTGKDSFKDVYSVMNDWGANHCAAAYGHIGADLIT
LASMLRIPVSMHNVSEDRIFRPKAWKAFGTKDLEGADFRACKHFGPLFGKVTR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaatgcaaaataatttaccaaaagtaggtattagacctgttatagatggtaga
agaaatggtgttagagaatctctcgaagacactactatgaatatggctaaaatagctgca
aaacttatagaagaaaatattaaacatcctagcggtgaaaaagttgaatgcgtaatatct
gatactacaatcggtggagttgctgaagctgctagatgtcagaaaaaatttgatgaaaac
aatgttaaattaactcttactgttacaccttgttggtgttatggttctgaaactattgat
atgactcctgctatacctaaagcaatttggggtttcaatggtactgaaagacctggtgct
gtttacttggctgctgctgatgctggacatactcaattaggacttcctgtattctctatc
tatggtaaagatgttcaagatgcaggcgatgaaaatgttcctgatgatgttaaagaaaaa
atacttagattcgtaagagctggtcttgctgttgctactatgaaagatcaatcatacata
agtatgggttatgttgctatgggtattatgggttctatggttgatgctgaattcttactt
gactatttaggaatgagaactgaattcgtagatatgagtgaaatcaaaagaagattagaa
ttagaaatctatgataaagaagaattcaaaaaagcttgggaatgggctaaacaatgcaaa
tttggtgctgataacaataaagtaaaagcttctgatgaagagaaagaaaaagaatgggct
acttctattaaaatggctatgattatgcgtgatttaatggtaggcaatcctaaattagct
gaaatgggatatatagaagaagcacaaggtcataatgctatagttggcggtttccaaggt
caaagacattggactgactatatgcctaacggcgactttgctgaagctattcttaactca
tctttcgactggaacggtataagagaaccttatgttgttgctactgaaaatgactctttg
aatggtctttctatgttattcgctcatttactaacttgtaaatctcaattatttgctgat
gttagaacttattggagtcctgaagcagttaaaagagttacaggaaaagaacttactgga
aaagctaaagacggtattattcacttaatcaattcaggtgctgcatctttagactggact
ggtgaagaaaaagttaatggaaatcctgctttaaaagaattctggaatatcactgaagaa
gaagctaaaaaatgtcttgatgcaactcaattctctcctgctaacagagaatatttcaga
ggaggcggattctcatctactttcttaactaaaggtgaaatgccaatgactataatcaga
cttaacttagttaaaggttatggtcctgtacttcaagtagctgaaggttatgctgttaat
attgatgatagtatatttgatcctattaacaaaagaactgactctacttggcctactact
tggtttgctcctatacttacaggtaaagactctttcaaagacgtttattctgtaatgaat
gattggggtgctaaccactgtgctgctgcttatggacatataggtgctgatttaattaca
ttagcttctatgttacgtatacctgtaagcatgcataatgttagtgaagatagaatattt
agacctaaagcttggaaagcatttggtacaaaagatttagaaggtgctgatttcagagct
tgtaaacattttggacctttatttggaaaagtaactaggtaa

DBGET integrated database retrieval system