KEGG   Brachyspira intermedia: Bint_2025Help
Entry
Bint_2025         CDS       T01847                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bip  Brachyspira intermedia
Pathway
bip00480  Glutathione metabolism
bip00590  Arachidonic acid metabolism
bip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bip00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Bint_2025
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bint_2025
Enzymes [BR:bip01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bint_2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-ProteinID: AEM22641
UniProt: G0EKY5
Position
complement(2330171..2330527)
Genome map
AA seq 118 aa AA seqDB search
MQDLYKKYKKDGFEILDFPCNQFGGQAKEPIEEIAEFRKEKYGITFKLFDKVKVNSKNAD
PLFTYLRTEKPTEEGVDKIRWNFGKFLIDRQGNIVGRYDPRVKPEELDEIVAELLKKE
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggatttatacaaaaaatataaaaaggatggttttgaaatattagactttccttgt
aatcaattcggcggacaggctaaagaacctattgaagaaattgctgagtttagaaaggag
aaatacggcattactttcaagctatttgacaaagttaaagttaatagtaaaaatgctgat
cctttatttacttatttaagaacagaaaagcctactgaagaaggcgttgataaaataaga
tggaatttcggtaagtttttaatagataggcaaggaaatatagttggacgctatgatcct
agagtaaagcctgaagaacttgatgagatagtagccgaattattaaaaaaagaataa

DBGET integrated database retrieval system