KEGG   Bacillus intestinalis: BIS30_03695Help
Entry
BIS30_03695       CDS       T05513                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bit  Bacillus intestinalis
Pathway
bit00061  Fatty acid biosynthesis
bit00071  Fatty acid degradation
bit01100  Metabolic pathways
bit01212  Fatty acid metabolism
bit02024  Quorum sensing
Module
bit_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BIS30_03695
   00071 Fatty acid degradation
    BIS30_03695
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BIS30_03695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bit01004]
    BIS30_03695
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bit04147]
    BIS30_03695
Enzymes [BR:bit01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     BIS30_03695
Lipid biosynthesis proteins [BR:bit01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   BIS30_03695
Exosome [BR:bit04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   BIS30_03695
  Exosomal proteins of breast cancer cells
   BIS30_03695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AJW84347
Position
complement(657043..658725)
Genome map
AA seq 560 aa AA seqDB search
MQSQKPWLAEYPEDIPHELPLPTQTLQSILTDSAARFPDKTAISFYGKKLTFHDILTDAL
KLAAFLQGNGLQKGDRVAVMLPNCPQTVISYYGVLFAGGIVVQTNPLYTEHELEYQLRDA
EASVIITLDLLFPKAIKMKTLSIVEQILITSVKDYLPFPKNILYPLTQKQKVHIDFDRKD
HIHMFASSMKEEKTELLTIPKIDPEHDIAVLQYTGGTTGAPKGVMLTHQNILANTEMCSA
WMYDVKEGAEKVLGIVPFFHVYGLTAVMNYSIKLGFEMILLPKFDPLETLKIIDKQKPTL
FPGAPTIYIGLLHHPELQHYDLSSIKSCLSGSAALPVEVKQKFEKVTGGKLVEGYGLSEA
SPVTHANFIWGKNKPGSIGCPWPSTDAAIYSEETGEHAAPYEHGEIIVKGPQVMKGYWNK
PEETAAVLRDGWLFTGDMGYMDEEGFFYIADRKKDIIIAGGYNIYPREVEEALYEHEAIQ
EIVVTGVPDSYRGETVKAFVVLKKGAKADAEELDTFARSRLAPYKVPKAYEFRKELPKTA
VGKILRRRLLEEEAENHHVK
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctcaaaagccgtggctagccgagtatcccgaagatatcccgcatgagcttccg
ttgccgacccaaaccctgcaatccatcctgacagactccgccgcacgattccctgacaaa
accgcaatatctttttatggaaaaaaactcacctttcatgacattctgacggatgctctt
aaactcgcagcttttttgcagggcaatggcctgcaaaaaggagacagagtggctgtcatg
ctgcccaattgcccgcaaacagtgatttcttattatggcgttttgtttgccggtggcatt
gtggtgcagacgaatccgctctataccgagcacgagcttgaataccagctgagagatgct
gaggcaagcgtgatcatcaccttagatttgcttttcccgaaggcaataaaaatgaaaacg
ttatcaattgtggagcagattttgatcaccagcgtaaaagattatttgccttttccgaag
aatattctttacccgctgacgcagaaacaaaaagtgcacatcgactttgacagaaaagat
cacattcacatgttcgcttccagcatgaaggaggaaaaaactgagctcttgacaatcccg
aagatcgatcctgaacatgatatcgctgtcctccaatatacaggaggaacaacgggggct
ccaaaaggagtcatgctcacgcaccaaaacattttggccaatactgaaatgtgctccgct
tggatgtacgatgtgaaggaaggggctgaaaaagtgctgggcatcgtcccgttttttcac
gtatacggactgacggcagtgatgaattattcgattaaactaggcttcgaaatgattctt
cttcctaagtttgatccgctcgaaacgctgaaaatcatcgacaaacaaaaaccgactctc
tttccgggtgcaccgacaatttacattggccttttgcatcaccccgaattgcagcattat
gatctgtcatccattaaaagctgtcttagcggctcagccgcactccctgtggaggtaaag
cagaaatttgaaaaggtgactggcggaaagcttgtggaaggctacggcttgtctgaggca
tccccagtgacacatgccaattttatctgggggaaaaacaagccgggcagtattggctgt
ccttggccgagtactgacgcagcgatctattcggaagagacgggtgagcatgccgctcca
tatgagcatggagaaatcattgtaaaaggtccgcaagtcatgaaaggatattggaacaaa
ccggaggaaactgccgctgtactgagagacggctggctgtttaccggagacatgggctat
atggatgaagagggctttttctatattgccgacaggaagaaggatatcatcatcgcgggc
ggctacaatatttatccgcgtgaagtagaagaagcactttatgaacatgaagccatccag
gaaattgtcgttaccggtgtgcctgattcctatagaggagaaacagtaaaagcatttgtc
gtgttaaagaaaggcgcaaaagccgatgcagaggaactggacacttttgcgagatcccgc
ctcgctccctacaaggtgccgaaagcctatgaattcagaaaagagctgccgaaaacggca
gtcggaaaaattttaagaaggcgtttacttgaagaagaagccgaaaatcatcatgtcaaa
taa

DBGET integrated database retrieval system