KEGG   Bacillus intestinalis: BIS30_04045Help
Entry
BIS30_04045       CDS       T05513                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
bit  Bacillus intestinalis
Pathway
bit00620  Pyruvate metabolism
bit01200  Carbon metabolism
bit02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BIS30_04045
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BIS30_04045
Enzymes [BR:bit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     BIS30_04045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ELFV_dehydrog DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AJW84410
Position
complement(730986..732218)
Genome map
AA seq 410 aa AA seqDB search
MSLREEALHLHKVNQGKLESKSKVEVRNAKDLSLAYSPGVAEPCKDIHEDINKVYDYTMK
GNMVAVVTDGTAVLGLGNIGPEAALPVMEGKAVLFKSFAGVDAFPIALNTNDVDKIVETV
KLLEPTFGGVNLEDIAAPNCFIIEERLKKETNIPVFHDDQHGTAIVTVAGLVNALKLSGK
SMSSIKVVANGAGAAGIAIIKLLHHYGVRDIVMCDSKGAIYEGRPEGMNDVKNEVAKFTN
QDRKDGSLKDVIVDADVFIGVSVAGALTKEMVQSMAKDPIIFAMANPNPEIMPEDAREAG
ASVIGTGRSDFPNQVNNVLAFPGIFRGALDVRATHINEEMKIAAVEAIASLVSEDELSAD
YVIPAPFDKRVAPAVAKAVAKAAMETGVARITVDPEEVAEKTRKLTIIGE
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaagagaagaagcattacacctgcataaagtcaatcaggggaaactggagtct
aaatcgaaagtagaagtcagaaacgcgaaagatttaagtcttgcgtattccccgggtgtt
gcagaaccgtgtaaggatattcatgaagacattaacaaagtatatgattatacaatgaag
gggaacatggtagcagttgtaactgacggtacagctgtgcttggccttggaaatatcggc
cctgaagccgcgcttcctgtcatggaagggaaagctgttctattcaaaagctttgcaggc
gtggacgcgttcccgattgctttaaacacaaacgatgttgataaaatcgttgaaactgtt
aaattgcttgaaccgacatttggcggcgtcaaccttgaagatattgcagcgccaaactgc
tttatcattgaagaacgcctcaaaaaagaaacaaacatcccggttttccatgatgatcag
cacggtactgccattgtaacggtagcaggtcttgtaaacgcgctgaaactgtctggaaaa
tccatgtcatccattaaagttgtcgcaaatggcgccggcgcagctggtattgcgattatc
aagcttcttcaccattacggcgtgcgtgacatcgtgatgtgcgattcaaaaggagcgatt
tatgaagggcgtccggaaggcatgaacgatgtcaaaaatgaagtggcgaaattcacaaac
caagaccgcaaagacggttctctgaaagatgtcatcgttgatgctgacgtgtttatcggt
gtgtctgtagcaggagcgttaacaaaagaaatggttcaaagcatggcaaaagatcctatt
atctttgcgatggcaaatccaaatccggaaattatgccggaagatgcgcgtgaagctggc
gcaagcgttattggaacgggccgttctgacttcccgaaccaagtaaacaatgttctagca
ttccctggtattttccgcggtgcgcttgacgttcgtgccactcacattaacgaagaaatg
aaaatcgcagcagttgaagccattgcttcactggtttcagaagatgagcttagcgcagac
tacgttatccctgcaccgtttgataaacgtgttgcgcctgccgttgcgaaagctgttgca
aaagcggcgatggaaacaggtgttgcaagaatcactgttgaccctgaggaagtcgcagaa
aaaacgagaaaacttacgattattggtgaataa

DBGET integrated database retrieval system