KEGG   Bacillus intestinalis: BIS30_04115Help
Entry
BIS30_04115       CDS       T05513                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bit  Bacillus intestinalis
Pathway
bit00430  Taurine and hypotaurine metabolism
bit00620  Pyruvate metabolism
bit00640  Propanoate metabolism
bit00680  Methane metabolism
bit01100  Metabolic pathways
bit01120  Microbial metabolism in diverse environments
bit01200  Carbon metabolism
Module
bit_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BIS30_04115
   00640 Propanoate metabolism
    BIS30_04115
  09102 Energy metabolism
   00680 Methane metabolism
    BIS30_04115
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BIS30_04115
Enzymes [BR:bit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BIS30_04115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AJW87430
UniProt: A0A063XE96
Position
complement(745025..746212)
Genome map
AA seq 395 aa AA seqDB search
MSKIIAINAGSSSLKFQLFEMPSETVLTKGLVERIGIADSVFTISVNGEKNTEVTDIPDH
AVAVKMLLNKLTEFGIIKDLNEIDGIGHRVVHGGEKFSDSVLLTDETIKEIEDISELAPL
HNPANIVGIKAFKEVLPNVPAVAVFDTAFHQTMPEQSYLYSLPYEYYEKFGIRKYGFHGT
SHKYVTERAAELLGRPLKDLRLISCHLGNGASIAAVEGGKSIDTSMGFTPLAGVAMGTRS
GNIDPALIPYIMEKTGQTADEVLNTLNKKSGLLGISGFSSDLRDIVEATKEGNERAETAL
EVFASRIHKYIGSYAARMSGVDAIIFTAGIGENSVEVRERVLRGLEFMGVYWDPALNNVR
GEEAFISYPHSPVKVMIIPTDEEVMIARDVVRLAK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaattattgcaattaacgcaggaagctcgtctttgaaatttcagcttttcgaa
atgccttcagaaaccgttttaacgaagggtttagttgaacgaattggtatcgccgacagc
gtattcacgatttctgtaaacggcgaaaaaaatacagaagtaactgatattccggatcat
gcggtagctgttaaaatgctgctgaacaagttaacggaattcggcattattaaagatttg
aatgaaattgacggaatcggccaccgcgtcgtgcacggcggagaaaaattcagtgattct
gttttattaactgatgaaaccattaaggaaattgaagatatttctgaattggcaccgctt
cacaacccggcaaatatcgttggaattaaagcgttcaaagaagtgcttccaaatgttcca
gcggttgctgtttttgatacggcattccaccaaacaatgcctgagcagtcttacctgtac
agcctgccgtatgaatactatgaaaagttcggcatccgtaaatacggcttccacggcact
tcacataaatatgtgactgagcgcgcggcagagcttctcggccgcccgttaaaagactta
cgcctgatttcctgccaccttggaaacggcgcaagtattgctgctgttgaaggcggaaaa
tcaattgatacatctatgggctttacgccgcttgcaggtgttgcaatgggtacacgctct
ggaaacatcgaccctgccctgatcccatacatcatggagaaaacaggccagacagctgac
gaagtactgaatacattaaacaaaaaaagcggcctgctcggcatctccggtttctcaagc
gatcttcgtgacatcgttgaagcaacgaaagaaggaaatgagcgcgcggaaactgctctt
gaagtcttcgcaagcagaatccacaaatacatcggttcttacgctgcaagaatgagcggt
gttgatgcgatcatctttactgccggtatcggtgaaaacagtgtggaagtcagagaacgc
gtgcttcgcggcttagaattcatgggcgtatactgggatcctgcgcttaataacgtgcgc
ggcgaggaagctttcatcagctatccgcattctccagtaaaagtcatgatcattccgact
gatgaagaagttatgattgcgcgcgacgttgtccgtttagcaaaataa

DBGET integrated database retrieval system