KEGG   Bacillus intestinalis: BIS30_07130Help
Entry
BIS30_07130       CDS       T05513                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bit  Bacillus intestinalis
Pathway
bit00520  Amino sugar and nucleotide sugar metabolism
bit01100  Metabolic pathways
bit01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BIS30_07130
Enzymes [BR:bit01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BIS30_07130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AJW84950
Position
1325731..1326921
Genome map
AA seq 396 aa AA seqDB search
MAESLLIKGIAIVTENEVIKNGYVGISEGKISTVSTERPKESYSKEIQAPADSVLLPGMI
DIHIHGGYGADTMDSSYSALDTMSSRLPEEGTTSFLATTITQEHGHISQALVNARDWKAA
EETSLLGAELLGIHLEGPFVSPNRAGAQPKEWIRPSDVALFKKWQMEAGGLIKIVTLAPE
EDQHFELIRYLKDESIIASMGHTDADSALLSEAAKAGASHMTHLYNAMSPFHHREPGVIG
TALAHDGFVTELIADGIHSHPLAAKLAFLAKGSTKLILITDSMRAKGLKDGVYEFGGQSV
TVRGKTALLSDGTLAGSILKMNEGARHMREFTNCSWTDIANITSANAAKQLGIFDRKGSV
TEGKDADLVIVSSDCEVILTICRGNIAFISKEADQI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaagtcttcttattaaaggcatcgcgatcgtgacagaaaatgaagtaatcaaa
aatggttatgtcggaatcagtgaaggaaaaatcagcacagtctcaacagaacggcctaaa
gagtcttattcaaaagagattcaagcaccggcagattccgttttgcttcccgggatgatt
gacattcatattcacggcggctatggcgcagatacaatggattcaagctattcagccctc
gacaccatgtcgtcaaggctgcccgaagaaggcacgacgagctttttagcaacaacgatt
actcaggaacatgggcacatttctcaagctttggtgaatgcaagagattggaaagcagct
gaggaaacctctttattaggtgcggaactgctcggcattcatttagagggcccctttgtt
tcacctaatagagccggggcgcaaccaaaggaatggatcaggccttcggatgttgcgctt
ttcaaaaagtggcagatggaggcgggcggactgatcaaaattgtcacactcgcgccggaa
gaggaccagcattttgaactgatccgctatttgaaagacgaatcgattattgcgtcgatg
gggcacacagatgccgactccgcattactatcggaggccgcgaaagcaggcgcgagtcat
atgacccatctttacaacgcgatgagcccgtttcatcaccgagagcccggggtgatcgga
acagcgcttgctcatgatgggtttgtgacagagcttattgccgacggcatccattcccat
cctttagcggctaagcttgctttcttggcaaaaggcagcaccaaactcattttaattacc
gattcaatgagggcaaaaggcctgaaagacggcgtatatgagttcggcggccaaagtgtg
acggtaagaggtaaaacagctcttctatcagacggaacacttgccggttcaatcctcaaa
atgaacgaaggtgcacggcatatgcgtgagtttacaaattgttcttggacggatatagct
aatataacttctgcaaacgcggccaaacagctgggcatctttgaccgaaaaggcagtgtg
acagaaggaaaagatgcggatcttgtcattgtcagcagtgattgcgaggtgattctcacc
atttgccgcggaaacattgcatttatatccaaggaggctgaccagatatga

DBGET integrated database retrieval system