KEGG   Bacillus intestinalis: BIS30_10600Help
Entry
BIS30_10600       CDS       T05513                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bit  Bacillus intestinalis
Pathway
bit00450  Selenocompound metabolism
bit00970  Aminoacyl-tRNA biosynthesis
bit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bit00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BIS30_10600
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BIS30_10600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bit01007]
    BIS30_10600
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bit03016]
    BIS30_10600
Enzymes [BR:bit01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BIS30_10600
Amino acid related enzymes [BR:bit01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BIS30_10600
Transfer RNA biogenesis [BR:bit03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BIS30_10600
 Prokaryotic type
   Other AARSs
    BIS30_10600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: AJW85575
Position
2018777..2020771
Genome map
AA seq 664 aa AA seqDB search
MPQENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQ
QKAEQENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTEKRHKVVIEKVFQKLLDNGDI
YLDEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKY
ADRLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPENPKHVVYVW
IDALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVF
AHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERIN
YDLANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDQTLTSVAEETVKAYEKAMENMEF
SVALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELHSVMYHLAESLRISAVLLQPFLTK
TPEKMFEQLGITDEALKAWDSITTFGQLKDTKVQKGEPLFPRLEAEEEIAYIKGKMQGSA
PAKEETKEEEPQEVDRLPEITIDQFMDVELRVAEVIQAEPVKKADRLLKLQLDLGFEKRQ
VVSGIAKHYTPEELVGKKLVCVTNLKPVKLRGELSQGMILAGEADGVLKVVSIDQSLPKG
TRIK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagaaaacaatacattttacattacaacaccgatttattatccgagcgggaaa
ttacatatcggccatgcatatacgacagtcgcgggagatgcgatggcacgctacaaaaga
ttaaaagggttcgatgttcgctatttaacaggaacggacgagcatggacaaaaaatccag
caaaaagctgaacaggaaaacattacacctcaggagtatgtggatcgtgcagcggcagat
attcagaaactgtggaagcagcttgaaatctcaaacgacgactttatccgtacgacagaa
aaacggcataaagttgtgattgaaaaggtgtttcaaaagcttcttgataacggggacatc
tatcttgatgaatatgaaggctggtacagtattccggatgaaacgttctacacggaaact
cagctggttgatatcgagcgaaatgaaaagggagaggtcatcggtggtaaaagccctgac
agcggacacccagttgaattaatcaaagaggaatcttatttcttccgtatgggtaaatat
gcggatcgtcttctgaaatactatgaagaaaacccgacatttattcagccggaatcacgc
aaaaacgaaatgattaacaactttatcaagcctggacttgaggatttggctgtatcacgt
accacttttgactggggtgtgaaggtgccggaaaatccaaagcacgttgtatatgtttgg
atcgacgcgctatttaactatttaacagcactcggttatgatacagaaaatgatgagctt
tatcaaaaatattggcctgccgatgttcatttagtcggtaaggagattgtgcgattccat
accatttactggccaattatgctgatggctctggatctgccgctgccgaagcaagtattt
gcgcatggctggcttttgatgaaagacggaaaaatgtcgaaatcaaaaggaaacgttgta
gatccggttacattaattgaacgctacggtttagatgagcttcgttattacctgcttcgc
gaagtgccattcggatcagacggtgtattcacgccggaaggttttgttgagcggattaac
tatgatttagcgaatgatttaggaaacctattgaatcgtacggttgcgatgatcaataag
tattttgacggacaaatcggttcttacaagggtgccgtgacggaatttgaccaaacgctc
acttcagtcgctgaagaaacagtgaaggcttatgagaaagcaatggaaaacatggaattc
tcggtagctctttcgacattatggcagctaatcagccgcacaaataaatacattgatgag
acagctccatgggtgcttgccaaagatccggcaaaagaagaagaactgcactcagttatg
tatcaccttgctgaatcattgcgtatttcagcagtgctgcttcagccgttcttaacaaag
acaccagagaaaatgttcgagcagctgggcattactgatgaagctttaaaagcttgggat
agcattacaactttcggccagctgaaagatacaaaagtacaaaaaggcgagccgttgttc
cctcgtttagaggcagaagaagaaattgcttacatcaaagggaaaatgcagggctcagcg
ccagctaaggaagaaacaaaagaagaagaaccgcaagaagttgatcgtttacctgaaatt
acgattgatcaatttatggatgtagaacttcgcgtggctgaggtcattcaggcagagccg
gtgaaaaaggcggaccgtttattgaagctgcagctggatcttggttttgaaaaacgccaa
gtcgtatccggcattgcgaagcattatacgcctgaagagcttgttgggaaaaaactcgtt
tgtgtaacaaatttaaaaccggttaaactgagaggagagctttctcaaggtatgatcctt
gcaggggaagcagacggcgtattaaaagtcgtgtctatcgatcagtcgttaccaaaaggc
acaagaattaaataa

DBGET integrated database retrieval system