KEGG   Bacillus intestinalis: BIS30_17190Help
Entry
BIS30_17190       CDS       T05513                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bit  Bacillus intestinalis
Brite
KEGG Orthology (KO) [BR:bit00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BIS30_17190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AJW86740
Position
complement(3281899..3282900)
Genome map
AA seq 333 aa AA seqDB search
MDILLILTILIVICALAFDFINGFHDTANAIATSVSTKALKPRHAIIMAAVMNFIGAMTF
TGVAKTITKDIVDPYTLENGSVVILAALIAAIAWNLITWYYGIPSSSSHAIIGAIAGAAI
ASAGFAALNYKGFIKIIEALIFSPLIAFVLGFILYSIVKVIFKDSNLAKTNKQFRRVQIV
TAALQSYTHGTNDAQKAMGIITMALITANLHTSSNDIPTWVQFACATAMGLGTSIGGWKI
IKTVGGKIMKIRPVNGVSADLTGAAIIFGATFIHLPVSTTHVISSSILGVGASHRVKGVN
WGTAKRMLITWVITLPISATLGAIAYFILNMIF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggatattttattaattttaacgatactaatagtcatttgtgctctggcgtttgatttc
atcaatgggtttcatgatacggcgaacgcaattgcgacttcagtatcgacaaaagcgctg
aaaccgcgccatgccattataatggcggctgtgatgaactttatcggagcaatgacattt
acaggtgttgccaaaaccattacgaaagacattgtagacccttatacattagaaaatggc
tctgtcgtaattttggctgcattaatcgctgcgattgcctggaacctgatcacatggtac
tacggcattccaagcagctcatctcatgccatcatcggagctattgccggtgccgccatt
gcgtcagccggatttgctgcgttaaattataagggattcattaaaatcattgaagcactt
atcttttcaccgcttattgcctttgtccttgggtttattctttacagcatcgtcaaggtg
atcttcaaagacagcaatttggcgaaaacgaacaagcaattccgcagagtgcagattgta
acagctgccctgcaatcgtatacacacggaacaaacgatgcgcaaaaagcaatgggaatt
atcacaatggctctcatcacagcgaatttacatacttcttctaacgatattccaacctgg
gtacaattcgcctgcgcgacagccatgggtctcggaacatcaatcggcggctggaaaatc
atcaaaaccgttggcggaaagatcatgaaaattcgtccggtaaacggtgtttctgctgac
ttaaccggtgcagctattattttcggcgccacatttattcatttgccggtcagtacaacc
cacgtcatttcttcatcaatccttggcgtcggtgcgtcacatcgggtaaaaggcgtaaac
tggggtacggccaagcggatgctcattacatgggtcatcacgcttccgatttcagcgaca
cttggtgccatcgcctactttattttaaatatgattttttaa

DBGET integrated database retrieval system