KEGG   Bos indicus (zebu cattle): 109553072Help
Entry
109553072         CDS       T04792                                 

Gene name
ERLIN1
Definition
(RefSeq) erlin-1
  KO
K23341  erlin
Organism
biu  Bos indicus (zebu cattle)
Brite
KEGG Orthology (KO) [BR:biu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109553072 (ERLIN1)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    109553072 (ERLIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Catalase-rel DUF4346
Motif
Other DBs
NCBI-GeneID: 109553072
NCBI-ProteinID: XP_019808519
Position
26
AA seq 348 aa AA seqDB search
MNMTQARVLVAGVVGLVVVLLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITT
FRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPCAVFDIVKNYTADYDKTLIFN
KIHHELNQFCSAHTLQEVYIELFDQIDENLKQALQKDLNVMAPGLTIQAVRVTKPKIPEA
IRRNFELMEAEKTKLLIAAQKQKVVEKEAETERKKAVIEAEKIAQVAKIRFQQKVMEKET
EKRISEIEDAAFLAREKAKADAEYYAAHKYATSNKHKLTPEYLELKRYQAIASNSKIYFG
NSIPSMFVDSSCALKYSDVRTGRKGSLPSKEALEPSGESPIQNKENTS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgactcaagcccgagttctggtggctggagtggtgggtctggtggtggtcctc
ctctacgcctccatccacaagatcgaggaaggacacctggccgtgtactacaggggagga
gctttgctaactagccccagtggaccgggctatcatatcatgttgcctttcattactacc
ttcagatccgtgcagacaacactacaaactgatgaagttaaaaatgtgccttgtggaaca
agtggtggggtcatgatctatattgaccgaatagaagtggttaatatgttggccccttgt
gcagtgtttgatatcgtgaagaactacactgcagattatgacaagaccttaatcttcaat
aaaatccaccatgaactgaaccagttttgcagtgcccatacacttcaagaagtttacatt
gaattgtttgatcaaatagacgaaaacctcaagcaagctctgcagaaagatttaaacgtc
atggccccaggcctcaccatacaggctgtgcgtgttacaaaacccaaaatcccagaagcc
ataagaagaaattttgagttaatggaggctgagaagacaaaacttcttatagctgcacag
aaacaaaaggttgtggagaaagaagctgagacagagaggaaaaaggctgttatagaagca
gagaagattgcacaagtggcaaaaattcggtttcagcagaaggtgatggagaaagaaact
gaaaagcgcatttctgaaattgaagatgccgcattcctggcccgagagaaggcgaaagca
gatgctgagtattatgccgcacacaaatatgccacctcaaacaagcacaaattgaccccg
gaatatctggagctcaaaaggtaccaggccattgcttctaacagtaagatctactttggc
aacagcatccctagcatgttcgtggactcctcctgtgctttgaagtattcagatgttagg
actggaagaaaaggttctctgccctctaaggaggctcttgaaccctctggagagagcccc
atccaaaacaaggagaatacaagttga

DBGET integrated database retrieval system