KEGG   Bos indicus (zebu cattle): 109553086
Entry
109553086         CDS       T04792                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01523  Antifolate resistance
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04062  Chemokine signaling pathway
biu04064  NF-kappa B signaling pathway
biu04068  FoxO signaling pathway
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04625  C-type lectin receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04668  TNF signaling pathway
biu04920  Adipocytokine signaling pathway
biu05010  Alzheimer disease
biu05132  Salmonella infection
biu05135  Yersinia infection
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05212  Pancreatic cancer
biu05215  Prostate cancer
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05222  Small cell lung cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109553086 (CHUK)
   04014 Ras signaling pathway
    109553086 (CHUK)
   04064 NF-kappa B signaling pathway
    109553086 (CHUK)
   04668 TNF signaling pathway
    109553086 (CHUK)
   04068 FoxO signaling pathway
    109553086 (CHUK)
   04151 PI3K-Akt signaling pathway
    109553086 (CHUK)
   04150 mTOR signaling pathway
    109553086 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109553086 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109553086 (CHUK)
   04621 NOD-like receptor signaling pathway
    109553086 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    109553086 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    109553086 (CHUK)
   04625 C-type lectin receptor signaling pathway
    109553086 (CHUK)
   04660 T cell receptor signaling pathway
    109553086 (CHUK)
   04658 Th1 and Th2 cell differentiation
    109553086 (CHUK)
   04659 Th17 cell differentiation
    109553086 (CHUK)
   04657 IL-17 signaling pathway
    109553086 (CHUK)
   04662 B cell receptor signaling pathway
    109553086 (CHUK)
   04062 Chemokine signaling pathway
    109553086 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109553086 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109553086 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109553086 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109553086 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109553086 (CHUK)
   05221 Acute myeloid leukemia
    109553086 (CHUK)
   05220 Chronic myeloid leukemia
    109553086 (CHUK)
   05215 Prostate cancer
    109553086 (CHUK)
   05222 Small cell lung cancer
    109553086 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109553086 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109553086 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109553086 (CHUK)
   05135 Yersinia infection
    109553086 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109553086 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    109553086 (CHUK)
   05162 Measles
    109553086 (CHUK)
   05164 Influenza A
    109553086 (CHUK)
   05161 Hepatitis B
    109553086 (CHUK)
   05160 Hepatitis C
    109553086 (CHUK)
   05168 Herpes simplex virus 1 infection
    109553086 (CHUK)
   05163 Human cytomegalovirus infection
    109553086 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109553086 (CHUK)
   05169 Epstein-Barr virus infection
    109553086 (CHUK)
   05165 Human papillomavirus infection
    109553086 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109553086 (CHUK)
   05142 Chagas disease
    109553086 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109553086 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109553086 (CHUK)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     109553086 (CHUK)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   109553086 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 109553086
NCBI-ProteinID: XP_019808554
Position
26
AA seq 740 aa
MERPPGLXXXAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSEMGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNTNLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSNIKEADSTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGVTPQLPPTSAEREHPLSCVVTPQDGETLAQMIEENLNCLGHLSTIIH
EANEKQGNNMMSLDWSWLTE
NT seq 2223 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctnnnnnnnnnngcgggcgggccctgggagatgcgggagcgg
ctgggcaccggcggcttcgggaacgtctgcctgtatcaacatcgggaacttgatctcaaa
atagcaattaagtcttgtcgcctagagctaagtaccaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccacgccaatgttgtaaaggcctgtgacgttcct
gaggaattgaattttttgattaacgatgtgcctctgctagcaatggaatattgttctgga
ggagatctccggaagctactcaacaaaccagaaaattgctgtggacttaaagaaagccag
atactttctttactgagtgatataggatctgggatccgatatttgcatgaaaacaaaatt
atacatcgtgatctaaaacctgaaaacatagttcttcaggatgttggtggaaagattatg
cataaaataattgatttgggatatgccaaagatgttgatcaaggaagtctttgtacatct
tttgtgggaactttgcagtatctggccccagagctctttgagaataagccttatacagcc
actgttgattattggagctttgggaccatggtgtttgagtgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagaaatgacaggagaagttcggtttagtagccayttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctgcagttgatgcta
aactgggatcctcagcagagaggaggacctgttgatcttactttgaagcagccaagatgt
tttgtattaatggatcacattctgaatttgaagatagtacatatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgggaaactggaataaatactggttctcaagagcttctttcagagatgggaatt
tccctggatcctcggaaaccagcctctcagtgtgttctggatggagttaggggctgtgat
agctatatggtttatttgtttgataaaagtaagactgtatatgaaggaccatttgcttcc
agaagtttatctgactgtgtaaattatattgtacaggacagcaaaatacagcttccaatt
atccagctgcgtaaagtrtgggcrgaagcagtacactatgtgtctgggctgaaggaagac
tacagcaggctctttcargggcagagagcagccatgttaagtcttcttagatataatact
aacttgacaaaaatgaaaaacactttgatctcagcatctcagcaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggaaagatatagtgagcagatgacttac
gggatatcctcagaaaaaatgttaaaagcatggaaagaaatggaagaaaaggctatccac
tatgctgaggtgggtgtcattggatacctggaggatcaaatcatgtccctgcacactgaa
atcatggagctacagaagagcccctacggacgacgtcagggagacttgatggaatctctg
gaacagcgygcaattgatctatataagcagttaaagcacagaccttcagatcactcctac
agcgacagcacggagatggtgaagatcattgtgcatactgtgcagagtcaggaccgggtt
ctcaaggagctgtttggtcatctgagcaagttgttgggctgtaagcagaagattattgat
ctactgcccaaggtggaaatggccctcagtaacatcaaagaagctgacagtactgtcatg
tttatgcaggggaagaggcagaaagaaatatggcatctccttaaaattgcctgtactcag
agttctgctcggtcccttgtaggatccagtctagaaggtgtaacccctcagctgccccca
acttcagcagaacgtgaacatcctctgtcatgcgtggtaactcctcaagatggggagact
ttagcacaaatgatagaagaaaatttgaactgtcttggccatttaagcactattattcat
gaagcaaatgaaaaacagggcaacaatatgatgagtcttgattggagttggttaacagaa
tga

KEGG   Bos indicus (zebu cattle): 109553353
Entry
109553353         CDS       T04792                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01523  Antifolate resistance
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04062  Chemokine signaling pathway
biu04064  NF-kappa B signaling pathway
biu04068  FoxO signaling pathway
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04625  C-type lectin receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04668  TNF signaling pathway
biu04722  Neurotrophin signaling pathway
biu04910  Insulin signaling pathway
biu04920  Adipocytokine signaling pathway
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05132  Salmonella infection
biu05135  Yersinia infection
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05212  Pancreatic cancer
biu05215  Prostate cancer
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05222  Small cell lung cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109553353 (IKBKB)
   04014 Ras signaling pathway
    109553353 (IKBKB)
   04064 NF-kappa B signaling pathway
    109553353 (IKBKB)
   04668 TNF signaling pathway
    109553353 (IKBKB)
   04068 FoxO signaling pathway
    109553353 (IKBKB)
   04151 PI3K-Akt signaling pathway
    109553353 (IKBKB)
   04150 mTOR signaling pathway
    109553353 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109553353 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109553353 (IKBKB)
   04621 NOD-like receptor signaling pathway
    109553353 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    109553353 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    109553353 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    109553353 (IKBKB)
   04660 T cell receptor signaling pathway
    109553353 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    109553353 (IKBKB)
   04659 Th17 cell differentiation
    109553353 (IKBKB)
   04657 IL-17 signaling pathway
    109553353 (IKBKB)
   04662 B cell receptor signaling pathway
    109553353 (IKBKB)
   04062 Chemokine signaling pathway
    109553353 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109553353 (IKBKB)
   04920 Adipocytokine signaling pathway
    109553353 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109553353 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109553353 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109553353 (IKBKB)
   05206 MicroRNAs in cancer
    109553353 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109553353 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109553353 (IKBKB)
   05221 Acute myeloid leukemia
    109553353 (IKBKB)
   05220 Chronic myeloid leukemia
    109553353 (IKBKB)
   05215 Prostate cancer
    109553353 (IKBKB)
   05222 Small cell lung cancer
    109553353 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109553353 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109553353 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109553353 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    109553353 (IKBKB)
   04931 Insulin resistance
    109553353 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109553353 (IKBKB)
   05135 Yersinia infection
    109553353 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109553353 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    109553353 (IKBKB)
   05162 Measles
    109553353 (IKBKB)
   05164 Influenza A
    109553353 (IKBKB)
   05161 Hepatitis B
    109553353 (IKBKB)
   05160 Hepatitis C
    109553353 (IKBKB)
   05168 Herpes simplex virus 1 infection
    109553353 (IKBKB)
   05163 Human cytomegalovirus infection
    109553353 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109553353 (IKBKB)
   05169 Epstein-Barr virus infection
    109553353 (IKBKB)
   05165 Human papillomavirus infection
    109553353 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109553353 (IKBKB)
   05142 Chagas disease
    109553353 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109553353 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109553353 (IKBKB)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     109553353 (IKBKB)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   109553353 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind ubiquitin GTSE1_N Med20 Glyco_hydro_65m
Other DBs
NCBI-GeneID: 109553353
NCBI-ProteinID: XP_019808885
Position
27
AA seq 784 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQSLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRTSAFEAHRESSCRWVLDVAERMYLELAWSSLQFPQSSQGP
PRSVFFQLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLA
FECITGFRPFLPNWQPVQWHSKVRQKSEMDIVVSEDLNGAVKFSSSLPHPNNLNSVLAQR
LEKWLQLMLMWHPRQRGTDPVYGPNGCFKALDDILNLKLLHVLNMVTGTLHTYPVTEDES
LQSLKARIRQDTGILEEDQELLQEAGLALIPDKPAAQCLSDGKLNEGRTLDMDLVFLFDN
SRVTYESQVSPQPQPESVSCILQEPKRNLPFFQLRKVWGQVWHSIQALKEDCSRLQQGQR
AAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSIQIDLEKYREQTEFGITSDKLLL
AWREMEQAVELCGRENEVKHLVERMMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYR
RLREKPRDQRTDGDSQEMVRLLLQAIQGFEKKVRVIYTQLSKTVVCKQKALELLPKVEEV
VSLMSEDEKMVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNASRLSHPCQLMSQPC
TAPDSLPEAAEKSEDLVAEAHTLCTQLENALQDTMKEQDQSLRSLDWSWLQSEEEEQQSL
ERAS
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctgccaacccagacatgtggggcctgggaaatgaaagagcgt
cttgggacagggggatttgggaacgtcatccgatggcacaatcaggagacgggcgagcag
atcgccatcaagcagtgccggcaagagctcagtccccggaaccgcgagcgctggtgcctg
gagatccagatcatgaggaggctgaaccaccccaatgtggtggccgcccgggacgtccct
gaaggcatgcagagcctggctcccaacgacctgcccctgctggccatggagtactgccag
ggcggggacctgcgcaagtacctgaaccagtttgagaactgctgcggcctgcgggaagga
gccatcctcaccttgctgagcgacattgcctctgcacttcgataccttcatgagaacaga
acctcagcttttgaagctcacagagaatccagctgtaggtgggttctggacgtggccgaa
aggatgtatttggagctggcctggtccagcctgcagtttccccagagctctcaggggccc
ccccgctcagttttcttccagttaatacacaaaattattgacctgggatacgccaaggag
ctggaccagggcagcctctgcacgtccttcgtggggaccctgcagtacctggcccccgag
ctgctggagcagcagaagtacacggtgaccgtggactactggagcttcggcaccttggcc
ttcgagtgcatcaccggcttccggcctttcctgcccaactggcagcccgtgcagtggcac
tccaaagtccggcagaagagcgagatggacatcgtggtaagcgaggacctgaacggggcc
gtgaagttctccagctcactgccgcaccccaacaacctcaacagcgtcctggcccagcgg
ctggagaagtggctgcagctgatgctgatgtggcacccgcgccagaggggcaccgaccct
gtctacgggcccaacggctgcttcaaggccctggacgacatcttgaacttgaagctgctt
catgtcctgaacatggtcacgggcaccctgcacacctaccccgtgaccgaggacgagagc
ctgcagagcctgaaggcccgcatccgccaggacacaggcatcctcgaggaggaccaggag
ctgctgcaggaggcagggctggccctgatccccgacaagcctgcmgcccagtgcctctcg
gacggcaagctgaacgagggccgcacgctggacatggacctcgttttcctctttgacaac
agcagggtcacctatgaaagccaggtctccccacagccccagcctgaaagcgtcagctgc
atcttgcaagagcccaagaggaacctcccgttcttccagctgcggaaggtgtggggccaa
gtctggcacagcatccaggccctgaaggaagactgcagccgcctgcagcagggccagcgc
gcggccatgatgaatctgctgcggaacaacagctgtctgtccaagatgaagaactccatg
gcctccatgtctcagcagctcaaggccaagctggacttctttaagaccagtatccagatt
gacctggagaagtacagggagcagacrgagtttgggatcacgtcggacaagctgctgcta
gcctggagggagatggagcaggccgtggagctctgcggacgggagaacgaggtgaagcac
ttggtggagcggatgatggccctgcagacggacatcgtggacctgcagcgcagccccatg
ggccggaagcagggcgggacgctggatgatctggaagagcaggcgcgggagctttaccgc
aggctgagggagaagcccagagaccagcggactgatggtgacagtcaggaaatggtgcgg
ctgctcctccaggcaatccaaggctttgagaagaaagtgcgagtgatttatacgcagctc
agtaagaccgtggtctgcaagcagaaggccctggaactgctgcccaaggtggaggaggtg
gtcagcctgatgagcgaggacgagaagatggtggtgcggctgcaggagaagcggcagaag
gagctctggaacctcctgaagattgcgtgtagcaaggtccggggtcccgtcagcggaagc
ccggacagtatgaacgcctcccgcctgagtcacccctgccagctgatgtcacagccctgc
acggctcccgacagcttgcccgaggccgccgagaagagtgaggacctggtggctgaagct
cacaccctgtgcacccagctggagaacgccctgcaggacaccatgaaggagcaggaccag
agtttgaggtctctagactggagctggttgcagtcggaggaggaggaacagcagagcctg
gagcgggcctcgtga

DBGET integrated database retrieval system