KEGG   Bos indicus (zebu cattle): 109553157
Entry
109553157         CDS       T04792                                 

Gene name
CASP7
Definition
(RefSeq) caspase-7
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04668  TNF signaling pathway
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05132  Salmonella infection
biu05133  Pertussis
biu05134  Legionellosis
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109553157 (CASP7)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109553157 (CASP7)
   04215 Apoptosis - multiple species
    109553157 (CASP7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109553157 (CASP7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109553157 (CASP7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109553157 (CASP7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109553157 (CASP7)
   05133 Pertussis
    109553157 (CASP7)
   05134 Legionellosis
    109553157 (CASP7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109553157 (CASP7)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     109553157 (CASP7)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C14: caspase family
   109553157 (CASP7)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 109553157
NCBI-ProteinID: XP_019808673
Position
26
AA seq 301 aa
MADDQGHIVEQGAEDPANNDTVDAKPDRSSFVSSIFSKKKKNDSGKSVNIPRDRVPTYQY
NMNFEKVGKCIIINNKNFDRITGMGVRNGTDKDAEALFKCFRSLGFDVSVYNDCSCAKMQ
DLLKKASEEDHRNSACFACILLSHGEENLIYGTDGKTAIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRNPGSGSW
FVQALCSILNEHGKSLEILQILTRVNDRVARHFESQSDDPRFHEKKQIPCVVSMLTKELY
F
NT seq 906 nt   +upstreamnt  +downstreamnt
atggcagacgatcaaggccatattgtggagcagggggctgaggatcccgcaaacaatgat
acagttgatgcaaagccagaccgrtcctcttttgtctcatcratcttcagtaagaagaag
aaaaatgactcagggaaatcagtcaacatcccccgggaccgagtgcctacgtatcagtat
aacatgaattttgagaaggtgggcaaatgcatcatcataaacaacaagaacttcgacaga
ataacaggaatgggtgtccgcaacggcacagacaaagatgcagaggctcttttcaagtgc
ttccggagcctgggtttcgatgtgagtgtctataacgactgctcttgtgccaagatgcaa
gatctgctgaaaaaagcttctgaagaagaccacagaaattcagcctgcttcgcctgcatc
ttattaagccatggagaagaaaatttaatttatggaacagatggcaagacagcaataaag
gacttgacagcccattttaggggggatcgatgcaaaaccctgttagagaaacccaaactc
ttcttcattcaggcttgccggggaacagagctcgatgacgggatccaggccgactcggga
cctatcaatgacactgatgctaatccccgttataagatcccagttgaagccgactttctc
tttgcctattccacagttccaggctattattcatggaggaacccagggagtggctcctgg
tttgtgcaggccctctgctccatcctgaatgagcatgggaagagcctggagatcttgcag
atcctcacccgggtgaatgacagggtggccaggcactttgaatcccagtctgatgaccca
cgcttccacgagaagaagcagattccatgtgtggtctccatgctcaccaaggaactctac
ttctga

DBGET integrated database retrieval system