KEGG   Bos indicus (zebu cattle): 109553201
Entry
109553201         CDS       T04792                                 

Gene name
MBL2
Definition
(RefSeq) mannose-binding protein C
  KO
K03991  mannose-binding lectin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04610  Complement and coagulation cascades
biu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109553201 (MBL2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109553201 (MBL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109553201 (MBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109553201 (MBL2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:biu04091]
    109553201 (MBL2)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109553201 (MBL2)
Lectins [BR:biu04091]
 C-Type lectins
  Group 3: Collectins
   109553201 (MBL2)
SSDB
Motif
Pfam: Lectin_C Collagen
Other DBs
NCBI-GeneID: 109553201
NCBI-ProteinID: XP_019808745
Position
26
AA seq 249 aa
MSLFTSLPFLLLTAVTASCADTETENCENIRKTCPVIACGPPGIXGIPGKDGRDGAKGEK
GEPGQGLRGSQGPPGKMGPQGTPGIPGIPGPIGQKGDPGENMGDYISLATSERATLQSEL
NQIKNWLIFSLGKRVGKKAFFTNGKKMPFNEVKTLCAQFQGRVATPMNAEENRALKDLVT
EEAFLGITDQETEGKFVDLTGKGVTYQNWNDGEPNNTSPGEHCVTLLSDGTWNDIACSAS
FLTVCEFSL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgtcgctgtttacatcacttccttttcttctcctgactgcggtgacagcatcttgtgca
gacacagaaacagagaactgtgagaacatccggaagacctgccccgtgattgcctgtggt
cctccgggcatcartggcatcccaggcaaagatgggcgtgatggtgccaagggagaaaag
ggagaaccaggtcaaggactcagaggctcgcagggccctcctggaaagatggggcctcaa
ggaacgccagggatccctgggataccaggaccaataggccaaaaaggagaccctggagaa
aatatgggtgactatattagcctggctacttcagaaagagcaactctacaatctgaattg
aaccagatcaaaaactggctaatcttctctctgggcaaaagagttgggaagaaggcattt
tttaccaatggtaaaaagatgccttttaatgaagtgaagactctgtgtgcacagttccag
ggccgtgtggccacccctatgaatgctgaagaaaacagggccctcaaggatttagtcact
gaagaggccttcctgggcatcacagatcaggagactgaaggcaaatttgtggatctgaca
ggaaagggggtgacctaccaaaactggaatgatggcgagcctaacaacacttctcctggg
gagcactgtgtgacacttctgtcggacggcacatggaatgacatcgcttgttccgcctcc
tttttgaccgtctgtgaattctctctctga

KEGG   Bos indicus (zebu cattle): 109553916
Entry
109553916         CDS       T04792                                 

Definition
(RefSeq) mannose-binding protein A-like
  KO
K03991  mannose-binding lectin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04610  Complement and coagulation cascades
biu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109553916
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109553916
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109553916
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109553916
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:biu04091]
    109553916
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109553916
Lectins [BR:biu04091]
 C-Type lectins
  Group 3: Collectins
   109553916
SSDB
Motif
Pfam: Lectin_C Collagen
Other DBs
NCBI-GeneID: 109553916
NCBI-ProteinID: XP_019809775
Position
28
AA seq 248 aa
MFLFSSLPVLLCLVTVSFSNTKAVEDAQKTCPVVACAIPVTNGTPGRDGRDGPKGEKGEP
GQGLRGSQGPPGKMGPPGNIGNPGLPGPRGYKGDRGDSSVAEAKLASLERQIRDLRSELD
HVKKLQTFSLGKKSGKKLYVTNREKMPFSSVKALCTALGATVATPKNAEENKAIQDLASD
TAFLGITDEVTEGQFMYVTGGRLGYSNWKKNEPNNYGSGEDCVSLLPDGLWNDISCSSSF
LAICEFPA
NT seq 747 nt   +upstreamnt  +downstreamnt
atgttcctgttttcatcacttcctgtcctcctgtgtttggtgacagtatccttctcaaat
acaaaagccgttgaggatgctcagaagacctgcccagtagtggcctgtgccatcccagtc
actaacggcaccccaggaagagacgggcgagatggacccaagggagaaaagggagagcca
gggcaagggctcagaggctcgcagggccctccagggaaaatggggcctccaggaaacata
gggaatcctgggcttccaggacccaggggctacaaaggagatcgtggagatagctcggtt
gctgaggctaagctggctagcttggagagacagataagggacctgcgatcagaactggat
cacgtcaaaaagttgcaaaccttctccttgggcaaaaagtctgggaagaagctgtatgtg
accaatcgtgaaaagatgcctttttccagcgtgaaggctctgtgcactgcacttggggct
accgtggccacacccaagaatgcagaggagaacaaagccatccaggacttggcctctgat
accgccttcctgggcatcacagatgaggtgactgaagggcagtttatgtatgtaactgga
ggaaggctaggctacagcaactggaagaagaatgaacccaataactatggctcaggggag
gactgtgtgagcctcttaccagacgggctctggaatgacatctcctgttcttcctccttc
ttggccatctgtgaatttccagcctga

DBGET integrated database retrieval system