KEGG   Bos indicus (zebu cattle): 109553313
Entry
109553313         CDS       T04792                                 

Definition
(RefSeq) putative claudin-24
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109553313
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109553313
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109553313
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109553313
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109553313
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109553313
  Exosomal proteins of colorectal cancer cells
   109553313
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 109553313
NCBI-ProteinID: XP_019808850
Position
27
AA seq 220 aa
MALVLRVAMQFVGILLSLLGWVLSIITTYLPHWKNLNLDLNDMENWTMGLWQACVIQEEV
GMQCKDFESFLGLPTELRVSRVLMFLSNGLGLLGLLXSGFGLDCLRIGETQRDVKKRLLI
LGGILFWTAGVTALVPVSWVAHVTVQEFWDERIPEIVPRWEFGEALFIGWFAGFSLLLGG
CLLNWAACGTQAPLASGRYAVAEMQTQCAYLENGXAHPSV
NT seq 663 nt   +upstreamnt  +downstreamnt
atggctttagttttgagagtagcaatgcaattcgttgggattttgctctcattgctggga
tgggttttatccattattacgacttacttgccacattggaaaaacctcaacctggactta
aatgacatggaaaactggaccatggggctctggcaagcctgtgtcatccaggaggaagta
gggatgcagtgcaaggactttgagtctttcctgggtttgcctactgagctcagggtctcc
agggttttaatgttcctctcgaatgggctggggctcctgggcctgctgrtgtcgggcttt
ggcctggactgcttgaggattggagagacacagcgggacgtcaagaagcggctgttgatc
ctgggaggaattctgttctggacagcgggcgtcacagccctcgttcccgtctcttgggtg
gcccacgtgacagtgcaggagttctgggacgagcgcatccccgagattgtgcccaggtgg
gagtttggagaggccctctttatcggctggtttgctggattttctctcctgctgggaggg
tgtctgctgaactgggctgcctgcgggacccaggctcccctggcttccggccgctatgca
gtggcagaaatgcaaactcagtgtgcatacctggaaaatggaaytgcccacccttcagta
taa

KEGG   Bos indicus (zebu cattle): 109553468
Entry
109553468         CDS       T04792                                 

Definition
(RefSeq) claudin-22-like isoform X1
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109553468
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109553468
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109553468
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109553468
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109553468
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109553468
  Exosomal proteins of colorectal cancer cells
   109553468
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 109553468
NCBI-ProteinID: XP_019809054
Position
27
AA seq 270 aa
MMALVFRAVAQLGGISLSLLGWVLSCLTNYLPQWKNFNLDLNEMENWTMGLWQACVVQEE
VGMQCKDFESFLGLPAELRISRVLMFVSNGLGFLGLLVSGFGLDCLRIGETQRDVKKRLL
ILGGILFWTAGVTALVPVSWVAHVTVQEFWDESIPEIVPRHIEKDKKEAVLRTWCSDRGD
GDECAPCPTWTWDPALRLLLPWKQPPPGTQGPLPPSLTGAHRRTEETRNRLLLNQVISQQ
SVQWDTRGVLPLFHFYKIKPTGNTAHLGTG
NT seq 813 nt   +upstreamnt  +downstreamnt
atgatggccttagtgtttagagcagtggcacaattaggtggaatttcattatccttgctg
ggatgggttttatcctgtctgacaaactacctgccgcaatggaagaatttcaacctggat
ttaaatgaaatggaaaactggaccatggggctctggcaagcctgtgttgtccaggaggaa
gtagggatgcagtgcaaggactttgagtctttcctgggtttgcctgctgagctcaggatc
tccagggttttaatgttcgtctcgaatgggctggggttcctgggcctgctggtgtcgggc
tttggcctggactgcttgaggattggagagacacagcgggacgtcaagaagcggctgttg
atcctgggaggaattctgttctggacagcgggcgtcacagccctcgttcccgtctcttgg
gtggcccacgtgacagtgcaggagttctgggacgagagcatccccgagattgtgcccaga
cacatagaaaaggacaaaaaggaagctgttctcaggacatggtgttccgacagaggtgat
ggagatgaatgcgccccctgtcccacgtggacctgggaccctgcactgaggctcctgctc
ccgtggaagcagccgcccccgggcacccagggtcccctgccaccaagcctcacgggggct
cacaggaggacagaggaaacgcgaaaccgccttctgctaaaccaagttatttctcaacag
tcggtccaatgggatacacgtggggtcctgcctctattccatttctacaaaataaagccc
actggcaatactgcacatttgggtaccgggtga

KEGG   Bos indicus (zebu cattle): 109553577
Entry
109553577         CDS       T04792                                 

Gene name
CLDN23
Definition
(RefSeq) claudin-23
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109553577 (CLDN23)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109553577 (CLDN23)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109553577 (CLDN23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109553577 (CLDN23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109553577 (CLDN23)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109553577 (CLDN23)
  Exosomal proteins of colorectal cancer cells
   109553577 (CLDN23)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like DUF872
Other DBs
NCBI-GeneID: 109553577
NCBI-ProteinID: XP_019809189
Position
27
AA seq 293 aa
MRTPVVMTLGMVLAPCGLLLTLTSTLTPGWRLVKGFLDQPLDLVLYQGLWDMCREQSSRE
RQCGQPDDLGYFAAEPVRVARGLMVTSLAVTGLGLLLATLGVRCWRDEPHFVLAGLSGVV
LFTAGLLSLIPVSWYNHFLADRTVLPAQPSPVTVQVGYSLVLGYLGSCLLLLGGFSLALS
FAPWCAERCDSCRKAPSSSARRSSISTVYIDGPEPALTPAIKYYSDGQHRPRPDQLGATS
QRKAGFPMPRPPPKAYSNPVDVLEGENATNSEPGSSSRSTRPCGSTLPCDSDV
NT seq 882 nt   +upstreamnt  +downstreamnt
atgcggacgccggtggtgatgacgctgggcatggtactcgcgccctgtgggctgttactc
accctgaccagcacgctgacgcccggctggaggctggtgaagggcttcctcgaccagccg
ctggacctggtgctgtaccagggcctgtgggacatgtgccgcgagcagagcagtcgcgag
cgccagtgcggccagccggacgacctcggctacttcgccgcggagccggtgcgcgtggcg
cggggactgatggtcacgtcgctggccgtcacgggcctggggctgctgctggcgacgctc
ggcgtgcgctgctggagggacgagccccacttcgtgctggccggcctctccggcgttgtg
ctcttcaccgcgggcctcttgagtctcatcccagtctcctggtacaaccacttcttggca
gatcgcaccgtcctgccggcccagcccagcccggtcacggtgcaggtcggctacagcctg
gtgctgggctacctgggcagctgcctgctgctgctgggcggcttctcgctggcgctcagc
ttcgcgccctggtgcgctgagcgctgtgacagctgccgcaaggcgccctccagcagcgcg
cgccgcagcagcattagcacagtgtacatcgacgggccagagcccgcactcacgccggcc
atcaagtattatagtgatggccagcaccggccgcggcctgatcagctgggcgccaccagc
cagcgcaaggccggcttcccgatgccccggcccccacccaaagcctacagcaacccggtg
gacgtgctcgaaggggagaacgctacaaactccgaacccggctcgtcttcccgcagcact
cggccctgcggcagcacgctgccctgcgactcggacgtgtag

KEGG   Bos indicus (zebu cattle): 109555504
Entry
109555504         CDS       T04792                                 

Gene name
CLDN2
Definition
(RefSeq) claudin-2
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109555504 (CLDN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109555504 (CLDN2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109555504 (CLDN2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109555504 (CLDN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109555504 (CLDN2)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109555504 (CLDN2)
  Exosomal proteins of colorectal cancer cells
   109555504 (CLDN2)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin DUF4064 Clc-like
Other DBs
NCBI-GeneID: 109555504
NCBI-ProteinID: XP_019811995
Position
X
AA seq 230 aa
MASLGLQLVGYVLGLLGLLGTVIAMLLPSWRTSSYVGASIVTAVGFSKGLWMECATHSTG
ITQCDIYSTMLGLPADIQAAQAMMVTSSAMSSLACIVSVVGMRCTVFFQESRAKDRVAVV
GGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIF
LCFSCSPQGNRSNYYDAYQAQPLATRSSPRPGQAPKGKSEFNSYSLTGYV
NT seq 693 nt   +upstreamnt  +downstreamnt
atggcctctcttggcctccagcttgtgggctacgtcctgggccttctggggctgttgggc
accgtgattgccatgctgctccccagctggcgaacaagctcctatgttggtgccagcatt
gtgactgcggttggcttctccaagggcctctggatggagtgtgcaacacacagcacaggc
atcacccagtgtgacatctacagcaccatgctaggcctgcctgctgacatccaagctgcc
caggccatgatggtgacatccagcgccatgtcctccttggcatgcattgtctctgtggtg
ggcatgagatgcacagtcttcttccaggagtctcgagccaaagacagagtggcggttgtg
ggcggagtcttcttcatccttggaggcctcctgggcttcattcctgttgcctggaatctt
cacgggatcttgcgagacttctactccccgctggtgcctgacagcatgaaatttgagatc
ggagaggctctttacctgggcattatttcctccctgttctccctgatagctggaatcttc
ctctgcttttcctgctcaccccagggaaatcgctccaactactacgatgcctaccaggcc
cagcccctggccactaggagctctccaaggcctggtcaagcgccgaaaggcaagagtgag
tttaactcctacagcctgacggggtatgtgtga

KEGG   Bos indicus (zebu cattle): 109556261
Entry
109556261         CDS       T04792                                 

Gene name
CLDN8
Definition
(RefSeq) claudin-8
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109556261 (CLDN8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109556261 (CLDN8)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109556261 (CLDN8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109556261 (CLDN8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109556261 (CLDN8)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109556261 (CLDN8)
  Exosomal proteins of colorectal cancer cells
   109556261 (CLDN8)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like FtsX YccF
Other DBs
NCBI-GeneID: 109556261
NCBI-ProteinID: XP_019813008
Position
1
AA seq 225 aa
MATYALQIAGLVLGGVGMVGTVAVTVMPQWRVSAFIESNIVVFENLWEGLWMSCMRHANI
RMQCKIYDSLLALSPDLQAARGLMCAASVLAFLAFLTAVLGMKCTRCAGDDDKVKGHILL
TAGVIFIITGLVVLIPVSWVANSIIRDFYNPIVDIAQKRELGEALYIGWTTALVLIVGGA
LFCCVSCCHEKSSSYRYSIPSHRTTQKSYHAEKKSPSVYSKSQYV
NT seq 678 nt   +upstreamnt  +downstreamnt
atggctacctacgccctgcaaatcgccggactggtgctcggtggtgtgggcatggtgggc
acagtggctgtcacggtcatgcctcagtggagagtgtctgccttcattgaaagcaatatt
gtggtctttgaaaacctctgggaaggactatggatgagttgcatgaggcatgctaacatc
agaatgcagtgcaaaatctacgactcgctgctggctctctctccggacctacaggcagcc
agaggactgatgtgtgccgcctcggtgctggccttcctggctttcctgackgccgtccty
ggcatgaagtgtaccagatgcgccggggacgacgacaaggtgaaaggtcacattctgctg
accgctggagtgattttcatcatcactggcctcgtggtgctcatccccgtgagctgggtt
gccaattccatcatcagagacttctacaacccaatagtggatattgcccagaaacgggag
ctgggagaagccctctacataggctggaccacggccctggtgctgattgttggaggggca
ctgttctgttgcgtttcctgttgccatgaaaagagcagtagctacagatactccataccg
tcccaccgaacaacccagaaaagctatcacgccgaaaagaagtcgccgagtgtgtactcc
aaaagtcagtacgtgtag

KEGG   Bos indicus (zebu cattle): 109556426
Entry
109556426         CDS       T04792                                 

Gene name
CLDN19
Definition
(RefSeq) claudin-19
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109556426 (CLDN19)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109556426 (CLDN19)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109556426 (CLDN19)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109556426 (CLDN19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109556426 (CLDN19)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109556426 (CLDN19)
  Exosomal proteins of colorectal cancer cells
   109556426 (CLDN19)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin SUR7
Other DBs
NCBI-GeneID: 109556426
NCBI-ProteinID: XP_019813256
Position
3
AA seq 224 aa
MANSGLQLLGYFLAMGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTG
QVQCKLYDSLLALEGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAI
AGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWAAAGLALLGGS
FLCCTCPEPERANNSPQPYRPGPSTAAREPVVKLSASTKGPLGV
NT seq 675 nt   +upstreamnt  +downstreamnt
atggccaactccggccttcagctcctgggctacttcctggctatgggtggctgggtgggc
atcatcgccagcacagccctgccgcagtggaagcagtcctcctacgcgggagacgctatc
atcaccgcygtgggcctctaygaagggctctggatgtcctgcgcctcccagagcaccggt
caggtgcagtgcaagctttatgactcgctgctcgccctggaaggtcacatccagtcagca
cgagccctgatggtggtggctgtgctcctgggcttcgtggccatggtcctcagtgtcgtc
ggcatgaagtgcacccgggtcggagacagcaaccccatcgccaagggccgtgtcgccatc
gctgggggtgccctcttcctcctggcgggcctctgcactttgacggccgtctcatggtat
gccaccctggtgacccaggagttcttcaaccccagcacacctgtcaacgccaggtacgag
ttcggcccagccctgtttgtgggctgggcggccgccggcctggccctgctgggcggctcc
ttcctctgctgcacgtgtccggagccggaacgagccaacaacagcccgcagccctaccgg
ccaggcccctccacggctgcccgagaaccagttgttaaattgtccgcctccaccaagggc
cccctgggtgtgtaa

KEGG   Bos indicus (zebu cattle): 109556733
Entry
109556733         CDS       T04792                                 

Gene name
CLDN16
Definition
(RefSeq) LOW QUALITY PROTEIN: claudin-16
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109556733 (CLDN16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109556733 (CLDN16)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109556733 (CLDN16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109556733 (CLDN16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109556733 (CLDN16)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109556733 (CLDN16)
  Exosomal proteins of colorectal cancer cells
   109556733 (CLDN16)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF1118 DuoxA
Other DBs
NCBI-GeneID: 109556733
NCBI-ProteinID: XP_019813722
Position
1
AA seq 301 aa
MTSKTPLWVTACLLRHLQRGARKRKRAVFSTSPGTRSTEDWQHSSHLHGPRAGSFPCSFP
DSLLAKMRDLLQYVACFFAFFSAGFLVVATWTDCWMVNADDSLEVSTKCRGLWWECVTNA
FDGIRTCDEYDSILAEHSLKLVVTRALMITADILAGFGFITLLLGLDCVKFLPDEPYIKV
RISFVAGTTLLIAGAPGIIGSVWYAVDVYVERSSLVLHNIFLGIQYKFGWSCWLGMAGSL
GCFLAGAILTCCLYLFKDVGPERSYPYSTRKAYSTTAVSMPRSHAIPRTQTAKMYAVDTR
V
NT seq 906 nt   +upstreamnt  +downstreamnt
atgacctccaagacccctctgtgggttacagcctgtttgttaagacacctgcagcgggga
gcaaggaaaaggaaaagagcagtattttcaacatccccaggaaccagaagcacagaagac
tggcagcattccagccacctgcatgggcccagggctggcagcttcccatgttcctttcca
gacagtctgctcgctaagatgagggatcttcttcagtatgttgcctgcttctttgctttt
ttctcygctgggttcttggttgtggccacctggacagactgttggatggtgaatgcagat
gactccctggaggtgagcacaaaatgccgaggcctctggtgggagtgtgtcacaaatgct
tttgatggaattcgcacctgtgatgagtatgattctatacttgctgagcactccttgaag
ctggtggtaactcgggcrctgatgattactgcagatattctagctggatttggatttatt
actctgctccttggacttgactgcgtgaaattcctccctgacgagccatacatcaaagtc
cgcatcagctttgttgctggaaccacgttactaatagcaggtgccccaggaataattggc
tctgtttggtatgctgttgatgtttatgtagaacgttcttctctggttttgcacaatata
tttcttggcatccaatataaatttggttggtcctgttggcttggaatggctggttctttg
ggttgttttttggctggtgctatcctcacatgctgcttatacctgttcaaagatgttgga
cctgagaggagctatccttattccacaaggaaagcctattcaacaacagctgtttccatg
ccccggtcacatgcgatccctcgaacacagactgccaaaatgtatgctgtcgacaccagg
gtgtga

KEGG   Bos indicus (zebu cattle): 109556744
Entry
109556744         CDS       T04792                                 

Gene name
CLDN1
Definition
(RefSeq) claudin-1
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109556744 (CLDN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109556744 (CLDN1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109556744 (CLDN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109556744 (CLDN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109556744 (CLDN1)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109556744 (CLDN1)
  Exosomal proteins of colorectal cancer cells
   109556744 (CLDN1)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin SUR7 Voltage_CLC YccF DUF4282 DUF898 T_cell_tran_alt DUF4134
Other DBs
NCBI-GeneID: 109556744
NCBI-ProteinID: XP_019813730
Position
1
AA seq 211 aa
MANAGLQLLGFILAFLGWIGSIVSTALPQWKVYSYASDNIVTAQAIYEGLWMSCVSQSTG
QIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEAQKMRMAV
FGGVIFLISGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFIGWAAASLCLLGGA
LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggccaacgcggggttgcagctgctgggcttcatcctggcgtttctgggctggatcggc
tccatcgtcagcacggcgctgccccagtggaaagtttactcctatgctagtgacaacatc
gtgacggcccaggccatctatgaggggctgtggatgtcctgcgtgtcgcagagcaccggg
cagatccagtgcaaagtcttcgactccttgctgaatctgaacagcactttgcaagcaacc
cgtgccttgatggtgattggcatcctgctgggactaatagccatctttgtggccaccgtt
ggcatgaagtgtatgaagtgcatggaagacgacgaggcacagaagatgcggatggctgtc
tttgggggcgtgatctttcttatttcaggtctggctattttagttgccacagcatggtat
ggcaatagaattgttcaagaattctatgaccccatgaccccggtcaatgccaggtatgaa
tttggtcaggctctcttcattggctgggctgctgcttctctctgccttctgggaggygcc
ctgctgtgctgctcctgtccccggaaaacaacatcttacccaacacccaggccctatccc
aagccagcaccttccagtgggaaagactatgtgtga

KEGG   Bos indicus (zebu cattle): 109558215
Entry
109558215         CDS       T04792                                 

Gene name
CLDN11
Definition
(RefSeq) claudin-11
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109558215 (CLDN11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109558215 (CLDN11)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109558215 (CLDN11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109558215 (CLDN11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109558215 (CLDN11)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109558215 (CLDN11)
  Exosomal proteins of colorectal cancer cells
   109558215 (CLDN11)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF2583 DUF2070 DUF3273
Other DBs
NCBI-GeneID: 109558215
NCBI-ProteinID: XP_019815254
Position
1
AA seq 208 aa
MMVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMA
TGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRR
AQLAGVMLILVALCAMVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVIVCCA
GDAQAFGENRFYYSSGSSSPTHAKSAHV
NT seq 627 nt   +upstreamnt  +downstreamnt
atgatggtggccacatgcttgcaggtagtgggcttcgtcacgagctttgtgggatggatc
ggcatcatcgtcaccacgtctaccaatgactgggtggtgacatgcggctacaccatcccc
acctgccgcaagctggacgagctgggctccaaggggctgtgggccgactgcgttatggcc
acggggctttaccactgcaagcccctggtggacatcctcatcctgccgggctacgtgcag
gcctgccgagccctgatgatcgctgcctccgtcctgggtctgccggctattctcctgctg
ctcacagttctcccgtgcatccgaatgggccacgagcctggcgtggccaagtacaggcgg
gcccarctggctggtgtcatgctcattcttgtggctctctgtgccatggtcgccaccatc
tggttccctgtgtgcgcccaccgtgagaccaccatcgtgagctttggctactccctgtac
gcgggctggattggtgccgtgctgtgcctcgtggggggctgtgtcatcgtctgctgcgct
ggagatgcccaggcgttcggggaaaatcgtttctactactcttcaggctccagttcccct
actcatgccaagagtgcccatgtataa

KEGG   Bos indicus (zebu cattle): 109561521
Entry
109561521         CDS       T04792                                 

Gene name
CLDN14
Definition
(RefSeq) claudin-14
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109561521 (CLDN14)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109561521 (CLDN14)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109561521 (CLDN14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109561521 (CLDN14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109561521 (CLDN14)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109561521 (CLDN14)
  Exosomal proteins of colorectal cancer cells
   109561521 (CLDN14)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin
Other DBs
NCBI-GeneID: 109561521
NCBI-ProteinID: XP_019819596
Position
1
AA seq 326 aa
MTRVPTQAHPKGHSNCLAASCSDALALKLPVSERGRXGGRQGPVESVGQAAWRPASSHSR
WESGEAAGTARALHDSSRRPSERAAAGEAMANTAVQLLGFLLCFLGLVGTLITTVLPHWR
RTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVVSCLLS
GAACASAVVGMQCTRCAKGTPAKTACAAVGGALFLLSGLLCLVAVSWTTHDVVQNFYNPL
LPSGMKFEIGQALYLGFIASALSLIGGTLLCLACQEEAPTRAPPRAAAVPTGAPAPAYRP
PDAYKDNRAPSAVSASHSGYRLNDYV
NT seq 981 nt   +upstreamnt  +downstreamnt
atgacacgtgtgcccacacaggctcatcccaaaggacacagtaattgtctagctgccagc
tgctcagatgccctggccttgaagctgccagtcagtgaaagagggaggtygggagggcgg
cagggtccggtggagtccgtgggtcaggccgcctggcgcccggccagttcccacagccgc
tgggaatccggcgaggcggctgggactgcaagggcgctgcatgactccagccggcgccca
agtgagcgggcagccgccggcgaggccatggccaacaccgccgtgcagctcctgggtttc
ctgctttgcttcctgggcctggtgggcacgctcatcaccaccgtcctgccgcactggcgc
cgcacggcgcacgtgggcaccaacatcctgacggccgtgtcctacctgaaggggctgtgg
atggagtgcgtgtggcacagcacgggcatctaccagtgccagatctaccgctcgctgctg
gcgctgccccgcgacctgcaggcggcgcgcgcgctcatggtggtgtcctgcctgctgtcg
ggcgccgcgtgcgccagcgccgtggtgggcatgcagtgcacgcgctgcgccaagggcacc
ccggccaagacggcgtgcgctgcggtgggcggcgcgctcttcctgctgtccggcctgctc
tgcctggtggccgtctcctggaccacccacgacgtggtgcagaacttctacaacccgctg
ctgcccagcggcatgaagtttgagatcgggcaggccctctacctcggcttcatcgcctcg
gccctgtcgctcatcggcggcacgctgctctgcctggcctgccaggaggaggcgcccacc
cgggccccgccccgggccgccgcggtccctaccggcgcccccgcgcccgcctaccggccc
cccgacgcctacaaggacaatcgggccccctcggccgtctcggcctcgcacagcggttat
aggctgaacgactatgtgtga

KEGG   Bos indicus (zebu cattle): 109563836
Entry
109563836         CDS       T04792                                 

Gene name
CLDN17
Definition
(RefSeq) claudin-17
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109563836 (CLDN17)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109563836 (CLDN17)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109563836 (CLDN17)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109563836 (CLDN17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109563836 (CLDN17)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109563836 (CLDN17)
  Exosomal proteins of colorectal cancer cells
   109563836 (CLDN17)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Claudin_3 Clc-like SUR7 DUF308 DUF4064 MFS_MOT1
Other DBs
NCBI-GeneID: 109563836
NCBI-ProteinID: XP_019822800
Position
1
AA seq 225 aa
MAFYPLQIAGLVLGFFGMIGTLTTTLLPQWRVSAFIGSNIIVFERVWEGLWMNCVRQAKD
KLQCKVYDSLLALPPALEAARALMCVAVALSVIALLVGICGMKKIQCTGSNRRAKAYLVG
ISGVLFILTGIFVLIPVCWMANNIIRDFYNPAVHVGQKRELGASLFVGWATTAVLIIGGV
LLCGFCCCNRNRPRHRYLAPGHRVPHARNPPRPVAVLSRTSTSYV
NT seq 678 nt   +upstreamnt  +downstreamnt
atggcattttatccactgcaaatcgctggactggttcttgggttcttcggcatgatcggg
acccttaccacaactcttctgcctcagtggagagtatcggcttttattggcagcaacatt
attgtcttcgaaagggtctgggaaggcctctggatgaactgcgtccgacaagccaaggat
aagttgcagtgcaaggtctatgattctttgctggccctccctcctgccctagaggcagcc
cgggccctcatgtgtgtggctgtagccttatctgtgattgctctgcttgttggtatctgt
ggcatgaagaagattcagtgcacaggctctaaccggagggcaaaagcatacctcgtggga
atttccggagtcctctttatcctgaccggcatcttcgttctgattccggtgtgctggatg
gccaataacatcatcagggatttctacaacccagcggtccacgtgggtcagaaacgagaa
ctgggagcttcactcttcgtcggctgggccactaccgcggtcctcatcatcggaggggtt
ctgctctgtgggttctgctgttgcaaccgaaacaggccaaggcacagatatttagcccct
gggcatcgtgtgccacatgcacgtaatccaccacggccagtggcagtgctcagtaggact
tccaccagttacgtctaa

KEGG   Bos indicus (zebu cattle): 109564073
Entry
109564073         CDS       T04792                                 

Gene name
CLDN20
Definition
(RefSeq) claudin-20
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109564073 (CLDN20)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109564073 (CLDN20)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109564073 (CLDN20)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109564073 (CLDN20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109564073 (CLDN20)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109564073 (CLDN20)
  Exosomal proteins of colorectal cancer cells
   109564073 (CLDN20)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 109564073
NCBI-ProteinID: XP_019823189
Position
9
AA seq 237 aa
MATAGVQLLAFALALSGVSGVLAATLLPNWKVNMDAGSNIITTIERLEGLWMDCTWYSTG
MFSCTLKYSVLALPSHEQAARAAMILACILSAVGICTSTVGMECTRLGGDXETKRHACFA
GGVCFLSAGTSGLIPTVWYTKEIIANFLDLTVPQSNKHEPGGAVYLGIISAVLLVISGMI
FCTSCLKKNSGALLHPCKQPPVSTAQPEDSSAYSLKDCVKNCVMHXEFLGACCDFCL
NT seq 714 nt   +upstreamnt  +downstreamnt
atggccacagcgggtgtccagctcctggctttcgccctggccttatctggggtctctgga
gtcctcgcggccacgctgctacccaactggaaggtgaacatggatgcgggctccaacatc
atcacgacyatcgagcggctggaagggctgtggatggactgcacgtggtacagcaccggg
atgttcagctgcactctgaagtactccgtcctggccctccccagccacgagcaggccgcg
agggccgccatgatcctggcctgcatcctgtctgcagtggggatctgcacttccacagtg
gggatggagtgcactcgcttaggaggggaccyggaaaccaagaggcatgcctgttttgct
ggaggagtttgtttcctgtctgcagggacctctggtttaataccractgtgtggtacaca
aaggagatcatagcaaactttctggacttgacggttccacaaagcaacaaacatgagcct
ggaggagctgtctaccttggaatcatttcggccgtgctgctggtgatctccggcatgatc
ttctgcacatcctgtctgaagaagaattcgggagctttgctccacccatgcaagcagccg
cccgtctccacygcacagccagaggacagttcggcatacagcctgaaggactgtgtgaag
aactgtgtgatgcacrtggaatttttaggtgcctgctgtgacttttgtctttaa

KEGG   Bos indicus (zebu cattle): 109564632
Entry
109564632         CDS       T04792                                 

Gene name
CLDN18
Definition
(RefSeq) claudin-18
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109564632 (CLDN18)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109564632 (CLDN18)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109564632 (CLDN18)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109564632 (CLDN18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109564632 (CLDN18)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109564632 (CLDN18)
  Exosomal proteins of colorectal cancer cells
   109564632 (CLDN18)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 109564632
NCBI-ProteinID: XP_019823607
Position
1
AA seq 261 aa
MSTTRCQVVGFLLSILGLAGCIVATEMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGF
TECRPYLTILGLPAMLQAVRALMIVGIVLSVIGLLVAIFALKCIRMGNMDDSAKAKMTLT
SGIMFIIAGLCAIAGVSVFANMLVTNFWMSTASMFTSMGGMVQTVQTRYTFGAALFVGWV
AGGLTLIGGVLMCIACRGLAPEETNYKAVSYHASGHNVAYRPGGFKASSGFESNTRNKKI
YDGGARTEDEGQSPPSKYDYV
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtccaccaccagatgccaagtggtgggcttcctgctgtccatcctgggcctggccggc
tgcatcgttgccacggagatggacatgtggagcacccaggacctatacgacaacccggtc
accgctgtgttccagtatgaagggctctggcgcagttgcgtgcagcagagctcaggcttc
accgagtgccggccctacctcaccatcctgggcctgccagccatgctgcaggcagtgcga
gccctgatgatcgtgggcatcgtcctgagtgtcattggcctcctggtggccatctttgcc
ctgaagtgcatccgtatgggcaacatggatgactccgccaaagccaaaatgacactcacc
tccgggatcatgttcatcatcgcaggtctctgtgcaatcgctggagtgtctgtgtttgcc
aacatgctggttactaacttctggatgtccacagccagcatgttcaccagcatggggggg
atggtgcagaccgttcagaccaggtacacctttggtgcggctctgttcgtggggtgggtc
gctggaggcctcacgctgattgggggcgtgctgatgtgcatcgcctgccggggtctggcc
cccgaggaaaccaactacaaagccgtctcttaccatgcctcaggccacaacgtcgcctac
aggcctggaggcttcaaagccagcagtggctttgagtccaacaccagaaacaagaagata
tatgatgggggtgcccgcacagaggatgagggacagtctcctccttccaagtacgactac
gtgtag

KEGG   Bos indicus (zebu cattle): 109566916
Entry
109566916         CDS       T04792                                 

Gene name
CLDN10
Definition
(RefSeq) claudin-10 isoform X1
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109566916 (CLDN10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109566916 (CLDN10)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109566916 (CLDN10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109566916 (CLDN10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109566916 (CLDN10)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109566916 (CLDN10)
  Exosomal proteins of colorectal cancer cells
   109566916 (CLDN10)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 YccF
Other DBs
NCBI-GeneID: 109566916
NCBI-ProteinID: XP_019827198
Position
12
AA seq 231 aa
MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKTCVTDSTGV
SNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALIGMKCTKVGGSDKAKAKIACLA
GIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCLIGGVIFC
FSISDNNKAPRMGYTYNGATSVMSSRTKYHGREGDLKTPNPSKQFDKNAYV
NT seq 696 nt   +upstreamnt  +downstreamnt
atggcgagcacggcgtcggagatcattgccttcatggtctccatctccggctgggtgctg
gtgtcctccacgctgcccaccgactactggaaggtgtccaccatcgacggcacggtcatc
accaccgctacctattgggccaacctgtggaagacgtgcgtcacggactccacgggcgtc
tccaactgcaaggactttccttccatgctggcgctggacggttacatccaggcgtgtaga
ggacttatgattgccgctgtcagcctgggctttttcggttccatattcgccctgattggc
atgaaatgtaccaaagtcggaggctcagataaagccaaagctaaaattgcgtgtttggct
gggattgtattcatactgtcagggctgtgctcaatgaccgggtgttccctgtatgcaaac
aaaatcacaacagaattctttgatcccctcttcgtggagcaaaagtatgagttaggagct
gctctgtttattggatgggcaggagcctcactctgcctaattggtggtgtcatattttgc
ttttcaatatctgacaacaacaaagcacccagaatgggatacacgtacaatggggccacr
tctgtcatgtcttctcggacaaagtatcacggcagagaaggagatcttaaaaccccaaac
ccttcaaaacagtttgacaaaaacgcatacgtctaa

KEGG   Bos indicus (zebu cattle): 109569480
Entry
109569480         CDS       T04792                                 

Gene name
CLDN25
Definition
(RefSeq) putative claudin-25
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109569480 (CLDN25)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109569480 (CLDN25)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109569480 (CLDN25)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109569480 (CLDN25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109569480 (CLDN25)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109569480 (CLDN25)
  Exosomal proteins of colorectal cancer cells
   109569480 (CLDN25)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 L_HMGIC_fpl
Other DBs
NCBI-GeneID: 109569480
NCBI-ProteinID: XP_019830399
Position
15
AA seq 230 aa
MSWSFHGKIQLGGLLLSLLGCICLCVTTILPRWKTLSLELNEMETWTMGLWEVCVDQEEV
ATVCKAFESFLSLPQELQASRILMVASHGLGLMGLLLSGFGAECFQFHRIRRVLKRRLCL
LGGTLEASAAATTLLPVSWVAYATIQDFWDDSIPEIVPRWEFGDALYLGWASGVFLALGG
LLLVFSACLGKEDVTFPHMAVPTTAPPSCAPAEVSDGSFYLMPRPRTLLI
NT seq 693 nt   +upstreamnt  +downstreamnt
atgtcctggagtttccacgggaaaatccagctagggggactgctcctttctctccttggc
tgcatctgcttatgcgtcaccactatccttccccggtggaagactctcagtctggagctg
aacgaaatggagacctggaccatggggctttgggaggtctgcgtggatcaggaggaagtc
gccaccgtgtgcaaagcctttgagtccttcctgtctctgccccaggagctccaggcgtcc
cgcatcctcatggtggcctcccatgggctcggactcatggggcttctgctctctggcttt
ggggctgaatgcttccagtttcataggatcagacgggtgcttaaaaggaggctttgtctc
ctgggagggactttggaggcatcagctgcggccactaccctccttcccgtctcctgggtg
gcctacgccacaatccaagacttctgggatgacagcatccctgagattgtgcctcggtgg
gagtttggagatgccctctacctgggttgggcttctggtgttttcctggcccttggtggg
ttactcctcgtcttctcagcctgcctgggaaaagaagatgtgacttttccccacatggct
gttcctacaacagccccaccatcctgtgctccagcagaggtatctgatggctcgttctac
ctaatgccaagacctaggaccctgctcatctag

KEGG   Bos indicus (zebu cattle): 109571458
Entry
109571458         CDS       T04792                                 

Gene name
CLDN5
Definition
(RefSeq) claudin-5
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109571458 (CLDN5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109571458 (CLDN5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109571458 (CLDN5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109571458 (CLDN5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109571458 (CLDN5)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109571458 (CLDN5)
  Exosomal proteins of colorectal cancer cells
   109571458 (CLDN5)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 109571458
NCBI-ProteinID: XP_019833514
Position
17
AA seq 331 aa
MGSAETRTAVPPAPAAHYPATRLPWAQLFLLLRLPAVPAIGCGQMAARGLAARGRGRAGR
GAESAPEPSKGKPLQTRPQTRGCTAVPRGLETERVSRARPEAPGRXXRVSPPAMGSAALE
ILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVY
DSVLALSPEVQAARALTVGAVLLALVALFVTLAGAQCTTCVAPGXAKARXALTGGALYAL
CGLLALVPLCWFANIVVREFYDPTVPMSQKYELGAALYIGWAASALLMCGGGLVCCGAWV
CTGRPDFSFPVKYSASRRPTATGDYDKKNYV
NT seq 996 nt   +upstreamnt  +downstreamnt
atgggctcggcagagaccaggacagcggttcctcccgcccccgcagcccactacccggct
acccggctaccctgggcgcagttgtttctcttactccggctgccggcggtgccagcgatt
ggctgcggacagatggccgcgcgcggattggctgcccgtggcaggggcagggccgggcgg
ggggcagagtccgcccccgaaccttcaaaagggaagcccctccagacgcgcccgcagacc
cgaggctgcactgcggtgccgcgaggcctggagactgaacgagtgagccgcgcgcgcccc
gaggccccgggccgnnnnncgcgcgtctcgcctccagccatggggtcggcggcgctggag
attctcggcttggtgctgtgcctggtgggctgggtgggcctgattctggcgtgcgggctc
cccatgtggcaggtgacggccttcctggaccacaacatcgtgacggcgcagaccacctgg
aaggggctgtggatgtcgtgcgtggtgcagagcacagggcacatgcagtgcaaggtgtac
gactccgtgctggcgctgagccccgaggtgcaggcggcgcgggccctcaccgtgggcgcc
gtgctgctggcgctcgtcgcgctgttcgtgaccctggcaggcgcccagtgcaccacctgc
gtggcccccggccnggccaaggcgcgcrtggcgctcacgggcggcgcgctctacgcgctc
tgcgggctgctggcgctggtgccgctctgctggttcgccaacatcgtggtccgcgagttc
tacgacccgaccgtgcccatgtctcagaagtacgagctgggagccgcgctctacattggc
tgggccgcctcggcgctgctcatgtgcggcggcggcctcgtgtgctgcggcgcctgggtc
tgcaccggccgcccggatttcagcttcccggtgaagtactcggcgtcgcggcggccgacg
gccaccggcgactatgacaagaagaactacgtctga

KEGG   Bos indicus (zebu cattle): 109573768
Entry
109573768         CDS       T04792                                 

Gene name
CLDN7
Definition
(RefSeq) claudin-7
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109573768 (CLDN7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109573768 (CLDN7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109573768 (CLDN7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109573768 (CLDN7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109573768 (CLDN7)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109573768 (CLDN7)
  Exosomal proteins of colorectal cancer cells
   109573768 (CLDN7)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 Clc-like OppC_N
Other DBs
NCBI-GeneID: 109573768
NCBI-ProteinID: XP_019836745
Position
19
AA seq 211 aa
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG
MMSCKMYDSVLSLPAALQATRALMVVSLVLGFLATFVATMGMKCTNCGGDDKVKKARIAM
TGGIIFILAGLAALIACSWYGHQIVSDFYNPLVPMNVKYEFGPAIFIGWAGSALVLLGGA
LLSCSCPGSESKAGYRAPRSYPKPNSAKEYV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggccaattcgggcctgcagctgctgggcttttccatggctctgctgggctgggtgggc
ctggtggcatgcaccgccatcccgcagtggcagatgagctcgtacgctggcgacaatatc
atcaccgcccaggccatgtacaaggggctgtggatggactgcgtcacgcagagcaccggc
atgatgagctgcaaaatgtacgactcggtgctctccctgccggcggccttgcaggccact
cgagccctaatggtggtctccctggtgctgggcttcctggccacattcgtggccacaatg
ggaatgaagtgtacaaactgtggaggagacgacaaagtgaagaaggcccggatagccatg
acgggaggcatcattttcatcttggcaggtcttgctgccttgatagcttgctcctggtac
ggccatcagattgtctcagatttctataacccattggtccccatgaatgttaagtatgaa
tttggtcctgccatcttcattggctgggcagggtctgctctggtcctcctgggaggtgcg
ctgctctcttgctcctgtcctgggagtgagagcaaagctggataccgtgcgcctcgctcc
taccctaagcccaactctgccaaagagtatgtgtga

KEGG   Bos indicus (zebu cattle): 109578262
Entry
109578262         CDS       T04792                                 

Gene name
CLDN9
Definition
(RefSeq) claudin-9
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109578262 (CLDN9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109578262 (CLDN9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109578262 (CLDN9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109578262 (CLDN9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109578262 (CLDN9)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109578262 (CLDN9)
  Exosomal proteins of colorectal cancer cells
   109578262 (CLDN9)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF872 TMEM100
Other DBs
NCBI-GeneID: 109578262
NCBI-ProteinID: XP_019842834
Position
25
AA seq 217 aa
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVIALLLALLGVLVAITGAQCTTCVEDEGAKARIVLT
AGVLLLLAGILVLIPVCWTAHAIIQDFYNPMVAEALKRELGASLYLGWAASALLLLGGGL
LCCTCPPPQIERPQGPRLGYSIPSRSGASGLDKRDYV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcttccactggccttgaactcctgggtatgaccctggctgtgctgggctggctgggg
accctggtgtcctgtgccctgcccctgtggaaggtgaccgccttcatcggcaatagcatc
gtggtggcccaggtggtgtgggaggggctgtggatgtcctgygtggtgcagagcacgggc
cagatgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggccgcc
cgggccctctgcgtcatcgccctcctgctggccctgctcggagtgctggtggccatcacg
ggcgcccagtgcaccacctgcgtggaggacgaaggagccaaggcccgcatcgtgctcacc
gcgggagtcctcctcctccttgcgggcatcctggtgctcatccccgtgtgctggacggcc
cacgccatcatccaggacttctacaaccccatggtggccgaggccctcaagcgggagctg
ggagcctccctctacctgggctgggccgcgtccgcccttcttctgctgggaggggggcta
ctgtgttgcacgtgccccccgcctcagatcgagcggccccagggaccgaggctgggctac
tctatcccctcccgctcgggggcatctgggctggacaagagggactacgtgtga

KEGG   Bos indicus (zebu cattle): 109578644
Entry
109578644         CDS       T04792                                 

Gene name
CLDN6
Definition
(RefSeq) claudin-6
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109578644 (CLDN6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109578644 (CLDN6)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109578644 (CLDN6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109578644 (CLDN6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109578644 (CLDN6)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109578644 (CLDN6)
  Exosomal proteins of colorectal cancer cells
   109578644 (CLDN6)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 GPDPase_memb DUF5336
Other DBs
NCBI-GeneID: 109578644
NCBI-ProteinID: XP_019843601
Position
25
AA seq 221 aa
MASAGLQILGIVLTLFGWVNALVSCTLPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVITLLVALLGLLVYLAGAKCTTCVEDKDSKARLVLT
SGIIFVISGVLTLIPVCWTAHTIIQDFYNPLVVEAQKRELGASLYLGWAASGLLLLGGGL
LCCTCPSGGSRSSSHYMARYSVSAPHTASRGPSEYPTKNYV
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcttccgctggtctgcaaatcctggggatcgtcctgactctgtttggctgggtgaat
gccctggtgtcctgcaccctgcccctgtggaaggtgaccgccttcatcggcaacagcatc
gtggtggcccaggtggtgtgggaggggctgtggatgtcctgcgtggtgcagagcacgggc
cagatgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggccgcc
cgggccctctgcgtcatcactctcctcgtggccctgcttggcctgctggtctaccttgcc
ggagccaagtgcaccacctgcgtggaggacaaggactccaaggcccgcctggtgctcacc
tctgggatcatctttgtcatctcgggggtcctgaccctgatccctgtgtgctggaccgcc
cacaccatcatccaggacttctacaaccctctggtggtcgaggcccaaaagcgggagctg
ggagcttccctctacctgggctgggcggcttccggccttttgttgctgggtggggggcta
ctgtgctgcacctgcccctctgggggctcccggagctccagccattatatggcccgatac
tcagtatcagccccacataccgcctctcggggtccctccgaataccccactaagaattac
gtctaa

KEGG   Bos indicus (zebu cattle): 109578682
Entry
109578682         CDS       T04792                                 

Gene name
CLDN15
Definition
(RefSeq) claudin-15 isoform X1
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109578682 (CLDN15)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109578682 (CLDN15)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109578682 (CLDN15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109578682 (CLDN15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109578682 (CLDN15)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109578682 (CLDN15)
  Exosomal proteins of colorectal cancer cells
   109578682 (CLDN15)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37
Other DBs
NCBI-GeneID: 109578682
NCBI-ProteinID: XP_019843667
Position
25
AA seq 235 aa
MPVAVEIFGFFLTAVGLLMLGVTLAHSSWRVSTVHGNVITTNTIFENLWYSCATDSMGVH
NCWEFPSMLALSGYIQACRALMITAILLGFLGLFLGMVGLRCTNIGGLELSRKTKLAATA
GALHILAGICGMVAVSWYAFNITRDFFNPLYAGTKYELGPALYLGWSACLLAILGGICLF
SNCCCSRDRDPATGVQLPYKAPVIPAASLAARLPAAASDEEGDSSFGKYGKNAYV
NT seq 708 nt   +upstreamnt  +downstreamnt
atgccrgtggctgtggagatcttcggcttcttcctcacagccgtggggctgctgatgctg
ggggtgactctggcacacagcagctggcgagtgtccaccgtgcatgggaatgtcatcacc
accaacaccatcttcgagaacctctggtacagctgtgccactgactccatgggagtccac
aactgctgggagttcccgtccatgctggccctctctgggtacatccaggcctgccgggcg
ctcatgatcaccgccatcctcctgggcttcctgggcctcttcctaggcatggtggggctg
cgctgcacgaacattgggggcctggagctctccagaaaaaccaagctggcggccaccgca
ggagccctacacatcctggctggtatctgcgggatggtggccgtctcctggtacgccttc
aacatcaccagggacttcttcaaccccttgtacgcaggaaccaagtacgagctgggccct
gccctctacttgggctggagcgcctgcctacttgccatcctgggcggcatctgcctcttc
tccaactgctgctgctctcgggaccgggaccccgccaccggcgtccagcttccctacaag
gcccccgtgataccggccgccagcctcgctgcccgcctgcccgccgcagcgtcggatgaa
gagggcgacagcagctttggcaagtacgggaagaacgcttacgtgtag

KEGG   Bos indicus (zebu cattle): 109578827
Entry
109578827         CDS       T04792                                 

Gene name
CLDN4
Definition
(RefSeq) claudin-4
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109578827 (CLDN4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109578827 (CLDN4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109578827 (CLDN4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109578827 (CLDN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109578827 (CLDN4)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109578827 (CLDN4)
  Exosomal proteins of colorectal cancer cells
   109578827 (CLDN4)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37 L_HMGIC_fpl DUF872 Clc-like DUF4131
Other DBs
NCBI-GeneID: 109578827
NCBI-ProteinID: XP_019843901
Position
25
AA seq 209 aa
MASMGLQVMGIALAVLGWLGAILSCALPMWRVXAFIGSNIVTSQTIWEGLWMNCVVQSTG
QMQCKVYDSLLALPQDLQAARALIVICIILAVFGVLLSVVGGKCTNCVDDESSKAKIMIV
AGVVFLLAGLLVMVPVSWTANNVIRDFYNPLVASGQKREMGASLYVGWAAAGLLILGGAL
LCFNCPPRNDKPYSAKYSAARSAPASNYV
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcttccatggggctgcaggtgatgggcatcgcgctggccgtgctgggctggctgggc
gccatcctgagctgcgcgctgcccatgtggcgcgtgrcggccttcatcggcagcaacatc
gtcacgtcgcagaccatctgggagggcctatggatgaactgcgtggtgcagagcaccggc
cagatgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggcggcc
cgtgccctcatcgtcatctgtatcatcctggccgtgtttggcgtgctgttgtcggtggtg
ggcggcaagtgcaccaactgtgtggatgatgagagctccaaggccaagatcatgatcgtg
gccggcgtggtgttcctgctggccggcctgctggtgatggtgcccgtgtcctggacggct
aacaacgtcatccgcgacttctacaaccccctggtggcctcgggccagaagcgggagatg
ggggcctcactctacgtgggctgggccgccgctggcttgctgatccttgggggggccctg
ctctgcttcaactgcccgccccgcaacgacaagccctactccgctaagtactccgccgcc
cgctccgccccagccagcaactacgtctaa

KEGG   Bos indicus (zebu cattle): 109578849
Entry
109578849         CDS       T04792                                 

Gene name
CLDN3
Definition
(RefSeq) claudin-3
  KO
K06087  claudin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
biu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109578849 (CLDN3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109578849 (CLDN3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109578849 (CLDN3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    109578849 (CLDN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109578849 (CLDN3)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   109578849 (CLDN3)
  Exosomal proteins of colorectal cancer cells
   109578849 (CLDN3)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37
Other DBs
NCBI-GeneID: 109578849
NCBI-ProteinID: XP_019843924
Position
25
AA seq 219 aa
MSMGLEIAGTSLAVLGWLCTIVCCALPMWRVTAFIGSSIITAQITWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVIAILLAVFGLLVALVGAQCTNCVQDDTAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIRDFYNPLVPEAQKREMGAALYVGWAASALQLLGGALL
CCSCPPRDNYARTKIVYSAPRSTGPVTSTGTAYDRKDYV
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtccatgggcctggagatcgcgggcacctcgctggccgtgctgggctggctgtgcacc
atcgtgtgctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcagcatcatc
acggcgcagatcacctgggagggactgtggatgaactgcgtggtgcagagcaccggccag
atgcagtgcaaggtgtacgactcactgctggcgctgccgcaggacctgcaggcggcccgc
gccctcatcgtcatcgccatcctactggccgtcttcgggctcctcgtggcgctcgtgggc
gcccagtgcaccaactgcgtgcaggacgacacggccaaggccaagatcaccatcgtggcg
ggcgtgctcttcctgctggccgccctgctgaccctcgtgccggtgtcctggtcggccaac
accatcatccgggacttttacaaccccttggtgcccgaggctcagaagcgsgagatgggc
gccgccctgtacgtgggctgggcggcgtccgcgctgcagctgctggggggcgcgctgctc
tgctgctcctgcccgccgcgcgacaactacgcgcggaccaagatcgtctactcggcgccg
cgctccaccgggcccgtcactagcaccggcacggcctacgaccgcaaggactacgtctga

DBGET integrated database retrieval system