KEGG   Bos indicus (zebu cattle): 109553316
Entry
109553316         CDS       T04792                                 

Gene name
CASP3
Definition
(RefSeq) caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04010  MAPK signaling pathway
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04650  Natural killer cell mediated cytotoxicity
biu04657  IL-17 signaling pathway
biu04668  TNF signaling pathway
biu04726  Serotonergic synapse
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05016  Huntington disease
biu05020  Prion disease
biu05132  Salmonella infection
biu05133  Pertussis
biu05134  Legionellosis
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05222  Small cell lung cancer
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109553316 (CASP3)
   04668 TNF signaling pathway
    109553316 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109553316 (CASP3)
   04215 Apoptosis - multiple species
    109553316 (CASP3)
   04115 p53 signaling pathway
    109553316 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109553316 (CASP3)
   04657 IL-17 signaling pathway
    109553316 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    109553316 (CASP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109553316 (CASP3)
   05206 MicroRNAs in cancer
    109553316 (CASP3)
   05205 Proteoglycans in cancer
    109553316 (CASP3)
   05203 Viral carcinogenesis
    109553316 (CASP3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109553316 (CASP3)
   05222 Small cell lung cancer
    109553316 (CASP3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109553316 (CASP3)
   05012 Parkinson disease
    109553316 (CASP3)
   05014 Amyotrophic lateral sclerosis
    109553316 (CASP3)
   05016 Huntington disease
    109553316 (CASP3)
   05020 Prion disease
    109553316 (CASP3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109553316 (CASP3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109553316 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109553316 (CASP3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109553316 (CASP3)
   05133 Pertussis
    109553316 (CASP3)
   05134 Legionellosis
    109553316 (CASP3)
   05152 Tuberculosis
    109553316 (CASP3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109553316 (CASP3)
   05162 Measles
    109553316 (CASP3)
   05164 Influenza A
    109553316 (CASP3)
   05161 Hepatitis B
    109553316 (CASP3)
   05160 Hepatitis C
    109553316 (CASP3)
   05168 Herpes simplex virus 1 infection
    109553316 (CASP3)
   05163 Human cytomegalovirus infection
    109553316 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109553316 (CASP3)
   05169 Epstein-Barr virus infection
    109553316 (CASP3)
   05165 Human papillomavirus infection
    109553316 (CASP3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109553316 (CASP3)
   05145 Toxoplasmosis
    109553316 (CASP3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109553316 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109553316 (CASP3)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     109553316 (CASP3)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C14: caspase family
   109553316 (CASP3)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 109553316
NCBI-ProteinID: XP_019808854
Position
27
AA seq 271 aa
MSMENTENSVDSKSIKTSETKILHGSKSMDSGISLEESYKMDYPEMGLCIIINNKNFHEN
TGMCRDSFHLRETFMNLKYEVRIKNDLTCKEMLELMSNVSKEDHSKRSSFICVLLSHGEE
GIIFGTNGPVNLKKLASFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGAEDDMAC
QKIPVEADFLYAYSTAPGYFSWRNAKNGSWFIQVLCEMLKKYAHRLELMHILTRVNRKVA
IEYESFSTDSAFHAKKQIPCIMSMLTKELYF
NT seq 816 nt   +upstreamnt  +downstreamnt
atgtccatggagaacactgaaaattcagtggattcaaaatccattaaaacttcagagaca
aagatcttacatggaagcaaatcaatggactctggaatatccttggaagagagttacaaa
atggattatcctgaaatgggtttatgtataataatcaataataagaacttccacgaaaat
actggtatgtgtcgtgacagttttcacctcagggaaacattcatgaacttgaaatacgaa
gtcaggattaaaaatgatcttacatgtaaagaaatgttggaattaatgagcaacgtttct
aaagaagaccatagcaaaaggagcagttttatttgtgtgcttctaagccatggtgaagaa
ggaatcatttttggaaccaayggacccgtcaatttgaaaaaattagcaagtttcttcaga
ggggactattgcagaagtctgactggaaaacccaaacttttcattattcaggcctgccga
ggcacagaactggactgtggtattgagacagacagtggtgctgaggatgacatggcctgt
cagaaaataccagttgaggcagacttcttgtacgcatattctacagcacctggttacttt
tcctggcgaaatgcaaagaacggatcctggttcatccaggttctttgtgagatgctgaaa
aagtacgctcacaggctcgagctcatgcacattcttactcgggttaaccgaaaggtagca
atagaatatgagtccttttctaccgattctgcttttcatgcaaagaaacagattccttgt
attatgtctatgctcacaaaagaactgtatttctaa

DBGET integrated database retrieval system