KEGG   Bos indicus (zebu cattle): 109553357
Entry
109553357         CDS       T04792                                 

Gene name
LMNA
Definition
(RefSeq) lamin
  KO
K12641  lamin A/C
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109553357 (LMNA)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109553357 (LMNA)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109553357 (LMNA)
   05414 Dilated cardiomyopathy
    109553357 (LMNA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:biu04812]
    109553357 (LMNA)
Cytoskeleton proteins [BR:biu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type V: Nuclear lamins
     109553357 (LMNA)
SSDB
Motif
Pfam: Filament LTD HAUS-augmin3 TPR_MLP1_2 ATG16 Crescentin TolA_bind_tri Cnn_1N Spc7 CENP-F_leu_zip Tht1
Other DBs
NCBI-GeneID: 109553357
NCBI-ProteinID: XP_019808892
Position
3
AA seq 664 aa
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLR
LRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARN
SKKEGDLMAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESR
LADALQELRAQHEDQVEQYKKXLEKTYSAKLDNARQSAERNSNLAGAAHEELQQSRIRID
SLSAXLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLADKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQSGSSVTKKRK
LESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLT
YRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVXVVEDDNDEDGDDLLHHHHGSHAGSSSGDPAEYNLRSRTVLCGTCGQPADKAS
ASSGXQVGGSISSGSSASSVTVTRSYRSVGGSGGGSFGDSLVTRSYLLGNSRPRTQSPQN
CSIM
NT seq 1995 nt   +upstreamnt  +downstreamnt
atggagaccccgtcccagcggcgcgccacccgcagcggggcgcaggccagctccaccccg
ctgtcacccacccgcatcacccggctgcaggagaaggaagacctacaggagctcaatgac
cgcttggctgtctacatcgaccgtgtgcgstcgctggaaacggagaatgcaggtctgcgc
cttcgcatcactgagtctgaggaggtggtcagccgcgaggtgtctggcataaaggccgcc
tacgaggccgagctgggggatgcccgcaagacccttgactcggtggccaaggagcgcgcc
cgcctgcagctggagctgagcaaagtgcgagaggagttcaaggagctcaaggcacgcaat
tccaagaaggagggagacctgatggccgcccaggcccggctcaaggacctggaggctctg
ctcaactccaaggaggccgcgctgagcactgctctcagcgagaagcgcacgctggagggc
gagctgcatgacctgcgggggcaagtggccaagctcgaggcagccctgggcgaggccaag
aagcaacttcaggatgagatgctgcgacgagtggatgctgagaaccggctgcagaccctg
aaggaggagctggacttccagaagaacatctacagcgaggagctccgtgagaccaaacgc
cgccacgagacgcgcctggtggagattgacaatgggaagcagcgagagtttgagagccgg
ctggcggatgccctgcaggagctgcgggcccagcacgaggaccaggtggagcagtacaag
aaggawctggagaagacctattcggccaagctggataaygccaggcagtccgcggagagg
aacagcaacctggcgggggccgcccacgaggagctgcagcagtcccgcatccgcatcgac
agcctctcggccmagctcagccagctccagaagcagctggcagctaaggaagcgaagctg
cgggacctggaggactcgytggcccgtgaacgcgacaccagccggcggctgctggcagac
aaggagcgggagatggcggaaatgcgggcaaggatgcaacagcagctggacgagtaccag
gagcttctggacatcaagctggccctggacatggagatccacgcctaccgcaagctcctg
gagggcgaggaggagaggctccgcctgtcccctagtcccacctcgcagcgcagccgaggc
cgggcctcctcccactcgtcccagacacagagtgggagcagcgtcaccaaaaagcgcaag
ctggagtccaccgagagccggagcagcttctcccagcatgctcgcaccagcgggcgcgtg
gccgtggaggaggtggacgaggaaggcaagttcgtgcgcctgcgcaacaagtccaacgag
gaccagtccatgggcaactggcagatcaagcgccagaatggagatgaccccctgctgacc
taccgcttcccaccaaagttcactctgaaggccgggcaggtggtgacgatctgggctgca
ggagctggggccacccacagcccccctactgacttggtgtggaaggcycagaacacctgg
ggctgcggaaacagcctgcgtacagctctcatcaactccactggggaagaggtggccatg
cgcaagctggtgcgctcagtgaycgtggtygaggacgacaacgatgaggatggagacgat
ctgctccatcaccaccacggctcccacgcaggcagcagctcgggggaccccgccgagtac
aacctgcgctcgcgcaccgtgctgtgcgggacttgcgggcagcccgcagacaaggcgtct
gccagctcgggarcccaggtgggcggatccatctcctctggctcctccgcctccagtgtc
acagtcactcgcagctaccgaagtgtggggggcagtgggggtggcagcttcggggacagc
ctggtcacccgctcctacctcctgggcaactccagaccccgaacccagagcccccagaac
tgcagcatcatgtaa

KEGG   Bos indicus (zebu cattle): 109561789
Entry
109561789         CDS       T04792                                 

Gene name
LMNB2
Definition
(RefSeq) lamin-B2
  KO
K07611  lamin B
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109561789 (LMNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:biu04812]
    109561789 (LMNB2)
Cytoskeleton proteins [BR:biu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type V: Nuclear lamins
     109561789 (LMNB2)
SSDB
Motif
Pfam: Filament LTD BRE1 FlaC_arch FPP PspB
Other DBs
NCBI-GeneID: 109561789
NCBI-ProteinID: XP_019820085
Position
7
AA seq 628 aa
MSPPSRGRRSEQRGPRKKTAAAXAMATPQPGRAGGPSTPLSPTRLSRLQEKEELRELNDR
LAHYIDRVRALELENDRLQLKISEREEVTTREVSGIKTLYEAELADARRVLDETARDRAC
LQIEMGKLRAELEEATKSAKKREGELTVAQGRVRDLESVFHRSEAELAAALSDKRTLEND
VAELRAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELAFRKDVFEEEVRETRRR
HERRLVEVDSSRQQEYDFKMAQALEELRAQHDEQVRLYRLELEQTYQAKLDNAKLSSDQN
DKAASAAREELKEARMRVESLSYQLSSLQKQASAAEDRIRELEETVAGERDKFRKMLDAK
EREMMEVRDMMQQQLAEYQELLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRITISR
ATTSSSGSSXXXXXXXXRSKRKRLEVZEPPGTGSSGLGSSSSTSSGGSFHLAQQASASGS
VSIEEIDLEGRFVQLKNSSDKDQSLGNWRIKRQVLEGEEISYKFTPKYVLRAGQTVTVWA
AGAGVAHSPPSTLVWKSQNSWGTGESFRTTLVNADGEEVAMRTVKQSSVVRETENGEEGE
DEAAEFGEEDLFHQQGDPRTTSRGCRVM
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgagcccgccgagccgcggccgccgttccgagcagcgcggaccccgaaaaaaaaccgct
gccgccgncgccatggccacgccgcagcccggccgcgcgggcgggccctccacgccgctg
tcgcccacgcgcttgtcgcggctgcaggagaaggaggagctgcgcgagctcaatgaccgc
ctggcgcactacatcgaccgcgtccgcgcgctggagctggagaacgaccggctgcagctt
aagatctccgagcgggaggaggtgaccacgcgcgaggtgagtggcatcaagacattgtac
gaggcagagctggctgacgcccgccgggtgctggacgagacggcccgggaccgcgcctgc
ctgcagatcgaaatgggcaagctgagggccgagctggaggaggccaccaagagcgccaag
aagagggagggtgagctcacggtggcccagggccgcgtcagggacctggagtccgtgttc
caccgaagtgaggccgagctcgcggccgcacttagtgacaagcgcaccttggagaacgat
gtggcagaactgcgggcccagctggctaaggcggaggatgggcatgcggtggctaagaag
cagctggagaaggagacgctgatgcgcgtggacctggagaaccgctgccagagcctgcag
gaggagctggccttccgcaaggatgtctttgaggaggaagtgcgtgagacgcggcggcgg
catgagcgccgcctggtggaggtggacagcagccggcagcaggagtatgactttaagatg
gcccaggcgctggaggaattgcgcgcccagcacgacgagcaagtgcggctgtaccgtctg
gaactggagcagacctaccaagccaagctggacaacgccaagctgagctccgaccagaat
gacaaggctgccagcgccgctcgggaggagctgaaggaggcccgcatgcgggttgaatcc
ctcagctaccagctctccagccttcagaagcaggcgagcgcggccgaggaccggatccgt
gaactagaggagaccgtggctggggagcgggacaagttccggaagatgctggacgccaaa
gaacgagaaatgatggaagtgcgggacatgatgcagcagcagctggccgagtaccaggag
ctgctggacgtcaagctggccctggacatggagatcagcgcctaccgcaagctgctggag
ggagaggaggagaggctgaagctgtcccctagcccgtcatcgcggatcaccatctctcgg
gccacaacgagcagcagcggcagcagtgnnnnnnnnnnnnnnnnnnnnnnccgcagcaag
cggaagcggctggaggtgsaggagccgccgggcacgggctccagtggcctcggctccagc
agcagcaccagcagcggcggcagcttccacctggcgcagcaggcctctgcctcaggcagc
gtcagcatcgaggagatcgatctggagggcaggttcgtgcaactgaagaacagctctgac
aaggatcagtctctgggcaactggaggatcaagaggcaggtcctggaaggggaggagatt
tcctacaagttcacccccaagtatgtgctgcgggccggccagactgtcacggtgtgggca
gctggagcgggggtggctcacagccccccatccacactcgtgtggaaaagccagaacagc
tggggcacyggtgagagcttccggaccaccctggtcaatgctgatggggaggaagtggcc
atgagaaccgtgaagcagtcttcagtggtgcgggagaccgagaatggggaggagggcgag
gacgaggcagctgagtttggagaggaggatcttttccaccagcagggggacccgaggacc
acctctcgaggctgccgcgtcatgtga

KEGG   Bos indicus (zebu cattle): 109561846
Entry
109561846         CDS       T04792                                 

Gene name
LMNB1
Definition
(RefSeq) lamin-B1
  KO
K07611  lamin B
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109561846 (LMNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:biu04812]
    109561846 (LMNB1)
Cytoskeleton proteins [BR:biu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type V: Nuclear lamins
     109561846 (LMNB1)
SSDB
Motif
Pfam: Filament LTD Spc7 DIT1_PvcA Atg14 PspB
Other DBs
NCBI-GeneID: 109561846
NCBI-ProteinID: XP_019820178
Position
7
AA seq 376 aa
MYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVKLYKEELEQTYHA
KLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAK
ERDNSRRMLSDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKL
SPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVD
GKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPP
TDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAEVAVEEELF
HQQGAPRGSNRSCAIM
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtatgaggaggagattaatgagaccagaaggaagcatgaaactcgcttggtagaggtg
gattctgggcgtcagattgagtacgagtacaagctggctcaagcccttcatgagatgaga
gagcaacaygatgcccaagtcaagctgtacaaagaagagctggagcagacgtaccacgcc
aaacttgaaaatgccagactgtcatcagagatgaatacttctactgtcaatagtgccaga
gaagaactgatggaaagtcgtatgagaattgagagcctctcgtctcagctttctaatcta
cagaaagagtctagagcatgtttggagaggattcaagagttggaggacttgcttgctaaa
gaaagagacaactctcgccgcatgctgtctgacaaagagagagagatggcggaaatacgt
gatcagatgcagcaacagttgaacgattatgaacaacttcttgatgtcaagttagccctg
gacatggaaattagtgcttataggaaactcctagaaggtgaagaagagagattgaagctc
tctccaagcccttcttcccgtgtaacagtgtcacgcgcatcctcgagtcgcagcgtgcgt
accaccagaggaaagcggaagagagtggacgtggaagaatccgaggccagcagtagtgtc
agcatctcccattctgcctcagccacagggaatgtctgcattgaagagatagatgttgat
ggaaaatttatccgcttgaagaacacttcggaacaggaccaaccaatgggaggctgggag
atgatcagaaaaattggagacacatcagtgagttacaaatatacctcaagatatgtgctg
aaggcaggccagactgttacaatctgggctgcgaatgccggtgtcacagccagtcctccc
accgacctcatctggaagaaccagaactcttggggcactggcgaagatgtgaaggttata
ttgaaaaattctcagggagaagaggttgctcagagaagtacagtcttcaaaacaaccata
cccgaagaggaagaggaggaggaagaagcagccgaagtggctgtcgaggaggaacttttc
caccagcagggagccccaagaggttccaacagaagctgtgcaattatgtaa

DBGET integrated database retrieval system