KEGG   Bos indicus (zebu cattle): 109553480
Entry
109553480         CDS       T04792                                 

Gene name
PLAT
Definition
(RefSeq) tissue-type plasminogen activator
  KO
K01343  tissue plasminogen activator [EC:3.4.21.68]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04371  Apelin signaling pathway
biu04610  Complement and coagulation cascades
biu05202  Transcriptional misregulation in cancer
biu05215  Prostate cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109553480 (PLAT)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109553480 (PLAT)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109553480 (PLAT)
  09162 Cancer: specific types
   05215 Prostate cancer
    109553480 (PLAT)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109553480 (PLAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109553480 (PLAT)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109553480 (PLAT)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     109553480 (PLAT)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109553480 (PLAT)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   109553480 (PLAT)
SSDB
Motif
Pfam: Trypsin Kringle fn1 EGF DUF1986 hEGF Trypsin_2
Other DBs
NCBI-GeneID: 109553480
NCBI-ProteinID: XP_019809076
Position
27
AA seq 566 aa
MMSAMKTEFLCVLLLCGAVFTSPSQETYRRLRRGARSYKVTCRDGKTQMTYRQHDSWLRP
LLRGNQVEHCWCDGGRAQCHSVPVRSCSEPWCFNGGTCRQALYSSDFVCQCPEGFMGKLC
EIDATATCYKDQGVAYRGTWSTAESGAECANWNSSGLAMKPYSGRRPNAIRLGLGNHNYC
RNPDQDSKPWCYVFKAGKYVSEFCSTPACAKVAEEDGDCYTGNGLAYRGTRSHTKSGASC
LPWNSVFLTSKIYTAWKSNAPALGLGKHNHCRNPDGDAQPWCHVWKDRQLTWEYCDVPQC
VTCGLRQYKRPQFRIKGGLFADITSHPWQAAIFVKNRRSPGERFLCGGILISSCWVLSAA
HCFQERYPPHHLKVFLGRTYRLVPGEEEQMFEVEKYIIHKEFDDDTYDNDIALLHLKSDS
LTCARESASVRTICLPDASLQLPDWTECELSGYGKHESSSPFFSERLKEAHVRLYPSSRC
TSQHLFNRTVTNNMLCAGDTRSGGDHTNLHDACQGDSGGPLVCMKDNHMTLVGIISWGLG
CGRKDVPGVYTKVTNYLDWIRDNTRP
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgatgagcgcaatgaagacagagttcctgtgcgtgctgctgctctgtggagctgtcttc
acgtcgcccagccaggaaacctacagacgactcaggagaggcgccagatcgtacaaagtg
acctgcagagatggaaaaacgcagatgacgtaccgccaacacgactcctggctgcgaccc
ctgctcaggggcaaccaagtggagcactgctggtgcgacggcggccgggcccagtgccac
tcggtgcccgtcagaagttgcagtgaaccttggtgtttcaatggggggacatgtcggcag
gccctctattcttcagactttgtctgccagtgcccagaagggttcatggggaagctctgt
gaaatagatgctaccgccacgtgctataaggaccagggtgtcgcctacagaggcacgtgg
agcacggcagagagcggggctgagtgcgccaactggaacagcagcggcctggccatgaag
ccgtacagcgggcgcaggcccaacgccatcaggctgggccttgggaaccacaactactgc
agaaacccggaccaagactcaaagccctggtgctacgtcttcaaggcagggaaatacgtc
tctgagttctgcagcactccagcctgcgctaaggttgcagaagaagatggggactgctac
actggaaacgggctggcgtaccgcggcacccgcagccacaccaagtctggggcttcctgc
ctcccgtggaattccgtgttcctaaccagcaagatttacaccgcctggaagagcaacgcg
ccggccctgggcctggggaagcacaaccactgcaggaatcccgatggggacgcccagcct
tggtgccacgtgtggaaggaccgccagctgacctgggagtactgtgatgtgccccagtgc
gtcacctgtggcctgagacagtacaagcggccccagttccgcatcaaaggaggcctcttc
gcggacatcacctcccacccctggcaggccgcgatcttcgtcaagaacaggcggtccccg
ggagagcggtttctgtgtggggggatcctgatcagctcctgctgggtgctgtcggccgcc
cactgcttccaggagaggtacccgcctcaccatctcaaggtgttcctgggcaggacgtac
cggctggtccctggagaggaggaacagatgtttgaagtagaaaaatacatcatccacaag
gaatttgatgatgacacttatgacaatgacatcgcgctgctgcacctgaaatcagactcg
ctgacctgcgcccgggagagtgcctccgtccgcaccatctgcctcccagacgccagcctg
cagctgcccgactggacggagtgcgagctgtccggctatgggaaacacgagtcctcttct
ccgttcttttccgagcggctgaaggaggctcacgtcaggttgtacccatccagccgctgc
acttcccaacacttgtttaacaggaccgtcaccaacaacatgctgtgtgccggagacaca
cggagcggtggggaccacacaaacctgcacgatgcctgccagggtgactcgggcggcccc
ctggtgtgtatgaaggacaaccacatgaccttggtcggcatcatcagctggggcctgggc
tgcgggcggaaggacgtcccgggcgtgtacaccaaggtgactaactacctggactggatc
cgagacaacactcgcccatga

DBGET integrated database retrieval system