KEGG   Bos indicus (zebu cattle): 109553537
Entry
109553537         CDS       T04792                                 

Gene name
F11
Definition
(RefSeq) coagulation factor XI
  KO
K01323  coagulation factor XI [EC:3.4.21.27]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109553537 (F11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109553537 (F11)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.27  coagulation factor XIa
     109553537 (F11)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109553537 (F11)
SSDB
Motif
Pfam: Trypsin PAN_1 PAN_4 Trypsin_2 DUF1986 PAN_2 MANEC
Other DBs
NCBI-GeneID: 109553537
NCBI-ProteinID: XP_019809150
Position
27
AA seq 625 aa
MTLLYQMVHFALFASVAGECVTTLFQDACFKGGDITVAFAPNAKHCQIICTHHPRCLLFT
FMTESSSEDPTKWYTCILKDSVTETLPMVNMTGAISGYSSKQCLHHISACSKDVYVDLNM
KGMNYNSSLAQSARECQQRCTDDTHCHFFTFATRRFPSIKDRNTCLLKNTQTGTPTSITK
LHEVVSGFSLKSCGXSNLACIRDIFPRTAFVDITIDTVXAPDPFVCRSICTHHPSCLFFT
FLSEEWPTASERNLCLLKTSSSGLPSARFRKNRAFSGFSLQHCQHSVPVFCHSSFYRNTD
FLGEELDIVDADSHEACQKTCTNSIRCQFFTYSPSQESCNGGKGKCYLKLSANGSPTKIL
HGTGSISGYTLRLCKMDNVCTTKIKTRIVGGTQSVHGEWPWQITLHVTSPTQRHLCGGAI
IGNQWILTAAHCFNEVXSPNVLRVYSGILNQSEIKEDTSFFGVQEIIIHDQYEKAESGYD
IALLKLETXMNYTDSQWPICLPSKGDRNVMYTECWVTGWGYRKLRDKIQNTLQKAKVPLM
TNEECQAGYREHRITSKMVCAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCG
QRERPGVYSNVVEYLDWILEKTQGP
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgactttattatatcaaatggtacatttcgctttatttgcctccgttgctggtgagtgt
gtgaccacgctgttccaagatgcctgctttaaaggaggagacatcactgtggctttcgcg
ccaaatgccaagcactgccaaatcatctgcacccaccacccaaggtgcttgctcttcact
tttatgactgaatcatcatcagaagatcctaccaagtggtatacttgcatcctgaaagac
agtgttacagaaacactgccaatggtgaatatgacaggagcaatttctggatattcttcc
aagcaatgcttgcaccacataagtgcttgcagcaaagacgtgtatgtggacctaaacatg
aaggggatgaactataacagctcccttgcccagagcgctcgggaatgccaacagaggtgt
acagacgacacgcattgccatttttttacattcgccacaaggcgctttccaagcataaag
gatcgtaacacttgyctgttgaagaacacccaaacrgggacaccaaccagcataacgaag
ctccacgaagtggtatctggattttctttgaagtcctgtggcytttctaacctggcttgt
attagggacattttccccagaacsgcgtttgtggacatcaccattgacactgtcrtggcc
ccagatccctttgtctgtcgcagcatctgtactcaccatcccagttgtctgttttttacc
ttcttgtctgaagaatggccaacagcatctgaaagaaatctgtgtctccttaaaacatct
tcaagtggattgccaagcgcacgctttagaaagaacagagctttttctggttttagtcta
caacactgccagcacagtgtcccagtgttctgccattcttcattctatcgcaacactgat
ttcttgggagaagaactggacatcgtagacgcggacagccaygaagcctgccagaaaaca
tgtaccaacagcatccgctgccagttctttacctattctccatctcaagaatcgtgcaac
ggagggaagggtaaatgctacttaaaactttctgcaaatggatctccaactaaaatactt
catgggacaggaagcatctctggatacacgttaaggttatgtaaaatggataatgtgtgt
acaaccaaaatcaagaccagaattgtaggaggaacccagtctgttcacggagagtggccg
tggcagataactctgcacgtgacatcacccacccagagacacctgtgtggaggcgccatc
atcggaaaccagtggatattaacagctgctcactgtttcaacgaggtcragtcacctaat
gtgttgcgtgtctatagcggcattttgaatcaatcagaaataaaagaggatacatctttc
tttggggttcaagaaataataattcatgatcaatatgaaaaggcagaaagtggatatgac
attgccttgttgaaactagaaacgrcaatgaattayacagactctcaatggcccatatgc
ctaccttccaaaggagatagaaatgtratgtatactgaatgctgggtgaccggatgggga
tacagaaaattaagagacaaaatacagaatactctccagaaagccaaggtacccttgatg
acmaatgaagaatgccaggcaggttacagagagcacagaataaccagcaagatggtctgt
gcaggctacagagaaggagggaaggaygcctgtaagggggattcaggggggcccctgtcc
tgtaagcacaacgaggtgtggcacctggtaggcatcacgagctggggtgaaggctgcggc
caaagggagcggccaggtgtttacagcaatgtggtcgagtacttggactggattctggag
aaaacgcaaggcccttga

DBGET integrated database retrieval system