KEGG   Bos indicus (zebu cattle): 109553560
Entry
109553560         CDS       T04792                                 

Gene name
KLKB1
Definition
(RefSeq) plasma kallikrein isoform X1
  KO
K01324  plasma kallikrein [EC:3.4.21.34]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109553560 (KLKB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109553560 (KLKB1)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.34  plasma kallikrein
     109553560 (KLKB1)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109553560 (KLKB1)
SSDB
Motif
Pfam: Trypsin PAN_1 PAN_4 Trypsin_2 DUF1986 PAN_2 MANEC
Other DBs
NCBI-GeneID: 109553560
NCBI-ProteinID: XP_019809178
Position
27
AA seq 636 aa
MIALRQAAYFICLFATVSCGCLTQLYHNTFFRGGDVSAMYTPDAQYCQLMCTFHPRCLLF
SFLPENSTSDADKRFGCFLKDSVTGTLPRVSRTGAISGHSLKRCGHQISACHRSIYKGID
MRGVNFNASKVRSAKECQERCTNNIHCQFFTYATKTFFSAEYRNTCLLKRSPQGTPTRIK
VLSDVESGFSLKACGNSKIGCRVDIFQHSAFSDVDVARIIAPDAFVCRTICTYHPSCLFF
TFYTNAWKTDSQRNVCFLKTSQSGSPSSPTPQENAVSGYSLLTCKQTLPGTEPCHSKIYP
QVAFEGEELHVTFVKGVDGCQETCTKMIRCQFFTYSLFPEDCRGEKCKCSLRLSLDGSPT
NITYGTQASSGYSLRLCKRGDSRVCTTKRTRIVGGTNASWGEWPWQVSLQVKQRAQSHLC
GGSIIGRQWVLTAAHCFDGLLLSNIWRIYGGILNLSEITTETSFSQIKEIIVHPNYKISE
GSHDIALIKLEAPLNFTDLQKAICLPSKDDTKPVYTDCWITGWGFTEEKGKIQNTLQKAN
IPLISNEECQKSYRDYKITKQMICAGYKEGGKDACKGDSGGPLVCQHEETWHLVGITSWG
EGCARREQPGVYTKVAEYVDWILEKTQDSHGQPLRK
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgattgcactcaggcaagcagcttactttatttgcctgtttgctacagtttcctgtgga
tgcttgactcaactatatcacaacaccttcttcagaggtggggatgtatcagccatgtac
accccagatgcccaatactgtcagctgatgtgcaccttccaccctaggtgcttgctcttt
agttttcttcctgaaaattcaaccagtgatgcagacaaaaggtttggttgcttcttgaag
gacagtgttacaggaaccctgccgagagtgtcacggacaggtgcaatttcgggacattct
ttaaagcgatgtggtcatcaaattagtgcttgccaccgaagcatttataaaggaatcgat
atgagaggagtcaatttcaatgcatctaaggtgagaagtgccaaagaatgccaagaaagg
tgcaccaacaacattcactgccagttcttcacatatgccacgaaaaccttcttcagtgca
gagtaccggaacacctgcctattaaaacggagcccacaggggacacccacgcgtataaag
gtgctgagtgatgtggagtctggattctcactgaaggcctgtggaaactcgaaaattggc
tgccgcgtggacattttccaacacagtgcgttttcagatgtggatgttgccagaattatc
gcaccagatgcttttgtgtgtcgaaccatctgcacctatcaccccagctgtcttttcttc
acattctatacaaatgcatggaagacagactcacagagaaatgtttgtttccttaagact
tcccaaagtgggagcccgagttcccctactcctcaggaaaatgccgtctctggatacagc
cttctaacctgcaaacaaactctgcctggcacagagccctgccactccaaaatttacccg
caagttgctttcgaaggagaagagctgcatgtgaccttcgtgaaaggagtggatggttgc
caagagacctgtacaaagatgattcgctgtcagttttttacttattctttattcccagaa
gactgtagaggagagaagtgtaaatgttccttacgcttgtctttggatggctccccaact
aacattacttaygggacgcaagcaagctctggttattccttgaggttgtgtaaacgtggg
gacagccgtgtctgtacaacaaaaaggacacgcattgttggaggaacaaatgcttcttgg
ggagagtggccctggcaggtcagcctgcaagtgaagcagagagctcagagccacctgtgc
ggagggtcaattattggacgccagtgggtcttaactgctgcccattgcttcgatgggctt
ctcttgtcaaatatttggcgcatttatggtggcattttaaatctgtcagagataacgaca
gagacgtctttctcacaaatcaaagagattattgtccacccaaattataaaatctcagaa
ggcagtcatgacattgccttaataaaacttgaggctcctttgaattttactgatttgcaa
aaagcaatatgcctaccttccaaagatgatacaaaaccagtttacactgactgttggata
actggatggggcttcacagaggaaaaaggtaaaatccaaaataccctacaaaaggcaaat
attcctttgatatcaaatgaagaatgccaaaaaagttacagagattataaaataaccaaa
cagatgatctgtgctggctataaagaaggaggaaaagatgcytgcaagggtgattcaggc
ggtcccttggtttgtcaacatgaagaaacatggcatttggtgggcatcactagttggggt
gaaggctgtgcccgcagggaacaaccaggagtctacaccaaagttgctgagtacgtggac
tggattttagagaaaacccaggacagccatggtcagcctttgaggaagtag

DBGET integrated database retrieval system