KEGG   Bos indicus (zebu cattle): 109553773
Entry
109553773         CDS       T04792                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04024  cAMP signaling pathway
biu04068  FoxO signaling pathway
biu04071  Sphingolipid signaling pathway
biu04137  Mitophagy - animal
biu04140  Autophagy - animal
biu04141  Protein processing in endoplasmic reticulum
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04310  Wnt signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04530  Tight junction
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04668  TNF signaling pathway
biu04722  Neurotrophin signaling pathway
biu04723  Retrograde endocannabinoid signaling
biu04728  Dopaminergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04910  Insulin signaling pathway
biu04912  GnRH signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04917  Prolactin signaling pathway
biu04920  Adipocytokine signaling pathway
biu04926  Relaxin signaling pathway
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05016  Huntington disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05132  Salmonella infection
biu05133  Pertussis
biu05135  Yersinia infection
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05231  Choline metabolism in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109553773 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109553773 (MAPK8)
   04012 ErbB signaling pathway
    109553773 (MAPK8)
   04014 Ras signaling pathway
    109553773 (MAPK8)
   04310 Wnt signaling pathway
    109553773 (MAPK8)
   04668 TNF signaling pathway
    109553773 (MAPK8)
   04068 FoxO signaling pathway
    109553773 (MAPK8)
   04071 Sphingolipid signaling pathway
    109553773 (MAPK8)
   04024 cAMP signaling pathway
    109553773 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109553773 (MAPK8)
   04137 Mitophagy - animal
    109553773 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    109553773 (MAPK8)
   04215 Apoptosis - multiple species
    109553773 (MAPK8)
   04217 Necroptosis
    109553773 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109553773 (MAPK8)
   04530 Tight junction
    109553773 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109553773 (MAPK8)
   04621 NOD-like receptor signaling pathway
    109553773 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    109553773 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    109553773 (MAPK8)
   04660 T cell receptor signaling pathway
    109553773 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    109553773 (MAPK8)
   04659 Th17 cell differentiation
    109553773 (MAPK8)
   04657 IL-17 signaling pathway
    109553773 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    109553773 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109553773 (MAPK8)
   04920 Adipocytokine signaling pathway
    109553773 (MAPK8)
   04912 GnRH signaling pathway
    109553773 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    109553773 (MAPK8)
   04917 Prolactin signaling pathway
    109553773 (MAPK8)
   04926 Relaxin signaling pathway
    109553773 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    109553773 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    109553773 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    109553773 (MAPK8)
   04722 Neurotrophin signaling pathway
    109553773 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109553773 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109553773 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109553773 (MAPK8)
   05231 Choline metabolism in cancer
    109553773 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109553773 (MAPK8)
   05212 Pancreatic cancer
    109553773 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109553773 (MAPK8)
   05012 Parkinson disease
    109553773 (MAPK8)
   05016 Huntington disease
    109553773 (MAPK8)
   05017 Spinocerebellar ataxia
    109553773 (MAPK8)
   05020 Prion disease
    109553773 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109553773 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109553773 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    109553773 (MAPK8)
   04931 Insulin resistance
    109553773 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109553773 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109553773 (MAPK8)
   05135 Yersinia infection
    109553773 (MAPK8)
   05133 Pertussis
    109553773 (MAPK8)
   05152 Tuberculosis
    109553773 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109553773 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    109553773 (MAPK8)
   05162 Measles
    109553773 (MAPK8)
   05161 Hepatitis B
    109553773 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109553773 (MAPK8)
   05169 Epstein-Barr virus infection
    109553773 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109553773 (MAPK8)
   05142 Chagas disease
    109553773 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109553773 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109553773 (MAPK8)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109553773 (MAPK8)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109553773 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 109553773
NCBI-ProteinID: XP_019809470
Position
28
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSR
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattc
acagtcctgaaacggtatcagaatttaaaacctataggttcaggagcccaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaacgttgcaatcaagaagttaagtcggcca
tttcagaatcaaactcatgctaagcgtgcttacagagagctagttctcatgaaatgtgta
aatcacaaaaatataattggccttttgaatgtttttacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgtcaagtgattcag
atggagctagatcatgaaagaatgtcctacctgctctatcagatgctgtgtgggatcaag
caccttcactctgctggaattattcaccgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctaggcatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactacaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgccggatatagctttgagaaactcttccctgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaga
atgctggtaatcgacgcatctaaaaggatttctgtagacgaagctctccagcacccgtat
atcaatgtctggtatgacccttctgaagcagaagctccaccaccaaagatacctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtcc
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcgtcagct
gggcctctgggctgctgtagatga

KEGG   Bos indicus (zebu cattle): 109560650
Entry
109560650         CDS       T04792                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04024  cAMP signaling pathway
biu04068  FoxO signaling pathway
biu04071  Sphingolipid signaling pathway
biu04137  Mitophagy - animal
biu04140  Autophagy - animal
biu04141  Protein processing in endoplasmic reticulum
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04310  Wnt signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04530  Tight junction
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04668  TNF signaling pathway
biu04722  Neurotrophin signaling pathway
biu04723  Retrograde endocannabinoid signaling
biu04728  Dopaminergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04910  Insulin signaling pathway
biu04912  GnRH signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04917  Prolactin signaling pathway
biu04920  Adipocytokine signaling pathway
biu04926  Relaxin signaling pathway
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05016  Huntington disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05132  Salmonella infection
biu05133  Pertussis
biu05135  Yersinia infection
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05231  Choline metabolism in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109560650 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109560650 (MAPK10)
   04012 ErbB signaling pathway
    109560650 (MAPK10)
   04014 Ras signaling pathway
    109560650 (MAPK10)
   04310 Wnt signaling pathway
    109560650 (MAPK10)
   04668 TNF signaling pathway
    109560650 (MAPK10)
   04068 FoxO signaling pathway
    109560650 (MAPK10)
   04071 Sphingolipid signaling pathway
    109560650 (MAPK10)
   04024 cAMP signaling pathway
    109560650 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109560650 (MAPK10)
   04137 Mitophagy - animal
    109560650 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    109560650 (MAPK10)
   04215 Apoptosis - multiple species
    109560650 (MAPK10)
   04217 Necroptosis
    109560650 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109560650 (MAPK10)
   04530 Tight junction
    109560650 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109560650 (MAPK10)
   04621 NOD-like receptor signaling pathway
    109560650 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    109560650 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    109560650 (MAPK10)
   04660 T cell receptor signaling pathway
    109560650 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    109560650 (MAPK10)
   04659 Th17 cell differentiation
    109560650 (MAPK10)
   04657 IL-17 signaling pathway
    109560650 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    109560650 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109560650 (MAPK10)
   04920 Adipocytokine signaling pathway
    109560650 (MAPK10)
   04912 GnRH signaling pathway
    109560650 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    109560650 (MAPK10)
   04917 Prolactin signaling pathway
    109560650 (MAPK10)
   04926 Relaxin signaling pathway
    109560650 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    109560650 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    109560650 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    109560650 (MAPK10)
   04722 Neurotrophin signaling pathway
    109560650 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109560650 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109560650 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109560650 (MAPK10)
   05231 Choline metabolism in cancer
    109560650 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109560650 (MAPK10)
   05212 Pancreatic cancer
    109560650 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109560650 (MAPK10)
   05012 Parkinson disease
    109560650 (MAPK10)
   05016 Huntington disease
    109560650 (MAPK10)
   05017 Spinocerebellar ataxia
    109560650 (MAPK10)
   05020 Prion disease
    109560650 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109560650 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109560650 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    109560650 (MAPK10)
   04931 Insulin resistance
    109560650 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109560650 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109560650 (MAPK10)
   05135 Yersinia infection
    109560650 (MAPK10)
   05133 Pertussis
    109560650 (MAPK10)
   05152 Tuberculosis
    109560650 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109560650 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    109560650 (MAPK10)
   05162 Measles
    109560650 (MAPK10)
   05161 Hepatitis B
    109560650 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109560650 (MAPK10)
   05169 Epstein-Barr virus infection
    109560650 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109560650 (MAPK10)
   05142 Chagas disease
    109560650 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109560650 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109560650 (MAPK10)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109560650 (MAPK10)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109560650 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 Kinase-like APH Kdo FTA2
Other DBs
NCBI-GeneID: 109560650
NCBI-ProteinID: XP_019818613
Position
6
AA seq 308 aa
MKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQML
CGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEV
ILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTV
RNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDAL
QHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQP
SPSAQVQP
NT seq 927 nt   +upstreamnt  +downstreamnt
atgaagtgtgtgaatcataaaaacattattagtttattaaatgtcttcacaccccagaaa
acactggaggagttccaagatgtttacttagtcatggagctgatggatgctaacttgtgt
caggtgattcagatggagttagaccacgagcgaatgtcttacctgctctaccaaatgttg
tgtggcatcaagcaccttcactctgctgggattattcacagggacttaaaaccaagtaac
attgtagtcaagtctgattgtacattgaaaatcctagactttgggctggccagaacagca
ggcacaagcttcatgatgactccctacgtggtaacacgttattaccgggcccccgaggtc
attctgggaatgggctacaaggagaacgtggatatatggtctgtgggatgcattatggga
gaaatggttcgccacaaaatcctgtttccaggaagggactatattgaccagtggaataag
gttattgagcaactaggaacaccatgtccagaattcatgaagaaattgcaacccaccgta
agaaactatgtggagaatcggcccaagtatgcaggactcaccttccccaagctctttcca
gattccctcttcccagcggactctgagcacaataaactcaaagccagccaagccagagac
ttgctgtcaaagatgctagtgattgacccagcaaaaaggatatcagtggatgacgcctta
caacatccgtacatcaatgtctggtatgaccctgctgaagtggaggcgcccccacctcag
atatatgacaaacagctggatgagagagagcacaccattgaagaatggaaagaacttatc
tataaggaagtaatgaactcggaagaaaagacgaagaatggcgttgtgaaaggacagcct
tctccttcagcacaggtgcagccgtga

KEGG   Bos indicus (zebu cattle): 109561331
Entry
109561331         CDS       T04792                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04024  cAMP signaling pathway
biu04068  FoxO signaling pathway
biu04071  Sphingolipid signaling pathway
biu04137  Mitophagy - animal
biu04140  Autophagy - animal
biu04141  Protein processing in endoplasmic reticulum
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04310  Wnt signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04530  Tight junction
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04668  TNF signaling pathway
biu04722  Neurotrophin signaling pathway
biu04723  Retrograde endocannabinoid signaling
biu04728  Dopaminergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04910  Insulin signaling pathway
biu04912  GnRH signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04917  Prolactin signaling pathway
biu04920  Adipocytokine signaling pathway
biu04926  Relaxin signaling pathway
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05016  Huntington disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05132  Salmonella infection
biu05133  Pertussis
biu05135  Yersinia infection
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05231  Choline metabolism in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109561331 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109561331 (MAPK9)
   04012 ErbB signaling pathway
    109561331 (MAPK9)
   04014 Ras signaling pathway
    109561331 (MAPK9)
   04310 Wnt signaling pathway
    109561331 (MAPK9)
   04668 TNF signaling pathway
    109561331 (MAPK9)
   04068 FoxO signaling pathway
    109561331 (MAPK9)
   04071 Sphingolipid signaling pathway
    109561331 (MAPK9)
   04024 cAMP signaling pathway
    109561331 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109561331 (MAPK9)
   04137 Mitophagy - animal
    109561331 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    109561331 (MAPK9)
   04215 Apoptosis - multiple species
    109561331 (MAPK9)
   04217 Necroptosis
    109561331 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109561331 (MAPK9)
   04530 Tight junction
    109561331 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109561331 (MAPK9)
   04621 NOD-like receptor signaling pathway
    109561331 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    109561331 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    109561331 (MAPK9)
   04660 T cell receptor signaling pathway
    109561331 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    109561331 (MAPK9)
   04659 Th17 cell differentiation
    109561331 (MAPK9)
   04657 IL-17 signaling pathway
    109561331 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    109561331 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109561331 (MAPK9)
   04920 Adipocytokine signaling pathway
    109561331 (MAPK9)
   04912 GnRH signaling pathway
    109561331 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    109561331 (MAPK9)
   04917 Prolactin signaling pathway
    109561331 (MAPK9)
   04926 Relaxin signaling pathway
    109561331 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    109561331 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    109561331 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    109561331 (MAPK9)
   04722 Neurotrophin signaling pathway
    109561331 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109561331 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109561331 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561331 (MAPK9)
   05231 Choline metabolism in cancer
    109561331 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109561331 (MAPK9)
   05212 Pancreatic cancer
    109561331 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109561331 (MAPK9)
   05012 Parkinson disease
    109561331 (MAPK9)
   05016 Huntington disease
    109561331 (MAPK9)
   05017 Spinocerebellar ataxia
    109561331 (MAPK9)
   05020 Prion disease
    109561331 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109561331 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109561331 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    109561331 (MAPK9)
   04931 Insulin resistance
    109561331 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109561331 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109561331 (MAPK9)
   05135 Yersinia infection
    109561331 (MAPK9)
   05133 Pertussis
    109561331 (MAPK9)
   05152 Tuberculosis
    109561331 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109561331 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    109561331 (MAPK9)
   05162 Measles
    109561331 (MAPK9)
   05161 Hepatitis B
    109561331 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109561331 (MAPK9)
   05169 Epstein-Barr virus infection
    109561331 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109561331 (MAPK9)
   05142 Chagas disease
    109561331 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109561331 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109561331 (MAPK9)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109561331 (MAPK9)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109561331 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 109561331
NCBI-ProteinID: XP_019819258
Position
7
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgatagtcagttttacagtgtacaagtggcagactcaactttc
acagtcctaaaacgataccagcagttgaaaccaattggctctggagcccaaggaattgtt
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcagactcatgcaaagagagcatatcgtgaacttgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagctggaccatgaaagaatgtcctaccttctttaccagatgctctgtggtattaaa
catctacattcagctggtataattcatagagatctgaagcctagtaacattgtagtaaag
tcagactgcaccctgaagatcctcgactttggcctggctcgtacagcgtgcaccaacttt
atgatgactccctatgtggtcacacggtattaccgggcacctgaagtcatcctgggcatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagttattgagcag
ctaggaacaccatctgcagatttcatgaagaaacttcagccaactgtgagraattatgta
gaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattc
ccatcagaatctgaacgagacaaaattaaaacaagtcaagccagagacttattatcaaaa
atgttagtgatagatcccgacaagcgaatctctgtagatgaagctttgcgtcacccttat
atcactgtttggtatgaccctgctgaagcagaagcgccaccaccccaaatttatgatgcc
cagttggaagagagagaacatgcaattgaagaatggaaagagctaatttacaaagaagta
atggattgggaagaaagaagcaagaatggtgttgtgaaagatcaaccttcagatgcagca
gtaagcagcaacgccactccttctcagtcgtcgtccatcaatgacatttcatccatgtcc
acggagcagacgctggcctcggacacagacagcagtctggacgcctcgacaggacccctg
gaaggctgtcgatga

DBGET integrated database retrieval system