KEGG   Bos indicus (zebu cattle): 109553885
Entry
109553885         CDS       T04792                                 

Gene name
PLAU
Definition
(RefSeq) urokinase-type plasminogen activator
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04064  NF-kappa B signaling pathway
biu04610  Complement and coagulation cascades
biu05202  Transcriptional misregulation in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109553885 (PLAU)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109553885 (PLAU)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109553885 (PLAU)
   05206 MicroRNAs in cancer
    109553885 (PLAU)
   05205 Proteoglycans in cancer
    109553885 (PLAU)
  09162 Cancer: specific types
   05215 Prostate cancer
    109553885 (PLAU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109553885 (PLAU)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109553885 (PLAU)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     109553885 (PLAU)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109553885 (PLAU)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   109553885 (PLAU)
SSDB
Motif
Pfam: Trypsin Kringle DUF316 Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 109553885
NCBI-ProteinID: XP_019809718
Position
28
AA seq 433 aa
MRVLLACLLVCALVVSDSDGSNEVHKESGESNCGCLNGGKCVTYKYFSNIQRCSCPKKFQ
GEHCEIDTSKTCYQGNGHSYRGKANRDLSGRPCLAWDSPTVLLKMYHAHRSDAIQLGLGK
HNYCRNPDNQRRPWCYVQIGLKQFVQFCMVQDCSVGKSPSSPREKEEFQCGQKALRPRFK
IVGGQVTNAENQPWFAAIYRRHRGGSITYLCGGSLISPCWVVSATHCFIDHPKKENYIVY
LGQSRLNSDTRGEMQFEVEKLILHEDYSAESLAHHNDIALLKIRTSRGQCAQPSRSIQTI
CLPPEHEDAHSRTRCEITGFGKENPSDYRYSDELKMTFVSLVSHEVCQQPHYYGAEVTDK
MLCAADPQWETDSCQGDSGGPLVCTIQGRLTLTGIVSWGRDCAMKYKPGVYTRVSKFLPW
INTHTRGEINLVL
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgagggtcctgctggcatgcctgctcgtctgtgccctggtcgtgagcgactctgatggc
agcaatgaagttcataaagagtctggtgaatcgaactgtggctgtctgaacggaggaaaa
tgtgtaacctacaagtacttctccaacattcagcgatgcagttgcccaaagaaattccaa
ggggaacactgtgagatagatacatcgaaaacctgctatcaggggaatggtcactcttac
cgagggaaggccaacagagacctcagtggccggccctgcctggcctgggactctcccacc
gtccttctgaaaatgtaccatgcccacagatctgatgccattcagctgggcctggggaaa
cacaattattgcaggaacccagacaatcagagaaggccctggtgctacgtgcaaattggc
ctaaagcagtttgtccagttctgcatggtgcaggactgctctgttggaaaaagtccctcc
tctcctagggagaaagaagagttccaatgtggccagaaggctctgaggcctcgctttaag
attgttgggggacaggtcaccaacgccgagaaccagccttggtttgcagccatctacagg
aggcatcgaggaggctccatcacctacttgtgtggtggcagcctcatcagtccctgctgg
gtggtcagcgccacacactgcttcattgatcacccaaagaaggagaactacattgtctac
ttgggtcagtcacggcttaactccgacacacgtggggagatgcagtttgaggtggaaaag
ctcatcttgcatgaggactatagtgcggagagccttgctcaccacaatgatattgccttg
ctgaagatccgtaccagcagaggccagtgtgcacagccctcccggtccatacagaccatc
tgcctgcccccagaacatgaagatgctcattctagaacaaggtgtgagatcactggcttc
ggaaaagagaatccctctgactatcgctactcagatgagctgaaaatgacttttgtgagt
ctggtttcccatgaggtgtgtcagcagccccactactatggcgctgaagtcactgacaaa
atgctatgtgcggctgacccacagtgggaaacagattcctgccagggagactcagggggc
cckctggtctgtaccatccaaggccgcctgaccctgactgggattgtgagctggggccgt
gactgtgccatgaartacaagccaggagtctacacaagggtctcaaaattcctgccctgg
atcaacactcacaccaggggagagattaaccttgtcctctga

DBGET integrated database retrieval system