KEGG   Bos indicus (zebu cattle): 109553933
Entry
109553933         CDS       T04792                                 

Gene name
PRF1
Definition
(RefSeq) perforin-1
  KO
K07818  perforin 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
biu04650  Natural killer cell mediated cytotoxicity
biu04940  Type I diabetes mellitus
biu05320  Autoimmune thyroid disease
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109553933 (PRF1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109553933 (PRF1)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    109553933 (PRF1)
   05330 Allograft rejection
    109553933 (PRF1)
   05332 Graft-versus-host disease
    109553933 (PRF1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109553933 (PRF1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109553933 (PRF1)
SSDB
Motif
Pfam: MACPF C2
Other DBs
NCBI-GeneID: 109553933
NCBI-ProteinID: XP_019809823
Position
28
AA seq 559 aa
MDSSSMAARVLLLGILLLLPTPAPAPCYTAARSECQRALKFVPGSWLAGEGVDVTSLQRS
GSFPVDTQRFLRPDGTCTLCRNALQKDVLQRLPLAITDWRAHGAGCKRRVVKLEGRSTED
VAGEAANRIRNDWQVGLDVSPKPNANVRVTVAGSHSZDANFAAQKTHQDNYRFSMDLVEC
RFYSFHLVHTPPVHPEFKRALKTLPPHFNTSTKPDYHRLISSYGTHFIRSMELGGRISAL
TALRTCELALEGLTASEVEDCLAVEAEVSISDRASASPSFKACEEKKKNHKVGTSFHQAY
RERHSNVDGGHHSTMHDLLFGSQAGPEQFSAWVASLQDSPGLVDYTLEPLHMLVESQDPR
REALRQAVSKYVTDRARWRDCNRPCPPGQHKNPKNPCQCXCPGSAATTQDCCPRQXGLAH
LEVMNFKASGLWGDWITATDAYLKVFFAGQEQRTATVWNDNNPRWMTRLDFGDVLLATGG
PLRVQVWDADSGWDDDLLGTCDRTPKSGSHEVSCPMDHGLLKFSYQVKCLPHLTGERCLQ
YAPQGLLGNPPGNRSGPVW
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggactccagctccatggctgcccgagtgctcctccttggcatcctcctgcttctgccc
acacctgcccctgccccctgctacacagccgcgcgctctgagtgccagcgcgccctcaag
tttgtgccgggctcctggctggcaggggagggcgtggatgtgaccagcctccagcgctca
ggctcgttcccagtggacacacagcgtttcctgcggcccgacggcacttgcaccctctgc
cgcaatgccctgcagaaggatgtcctccagcgcctgcccctggcaatcaccgactggcgt
gcccacggagcgggctgcaagcgcagggtggtcaagctagagggccgctccaccgaggat
gtggctggggaggcggccaacaggatccgcaacgactggcaggtggggctggacgtgtct
cccaagccaaatgctaatgtccgtgtgacagtggcgggctcccactccsaggatgccaac
ttcgccgcccagaagactcaccaggacaactaccgcttcagcatggacttagtggagtgt
cgcttttacagttttcacctggtgcacactcccccagtacaccctgagttcaagagggcc
ctcaagacactgcccccccacttcaacacctccaccaagcccgactaccacaggctcatc
tccagctacggaacccacttcatccggtccatggagctgggcggccgcatctcggccctc
accgccctgcgcacctgcgagctggccctggaggggctcacagccagcgaggtcgaggac
tgcctggctgtcgaggctgaggtcagcataagcgacagggccagtgcctcgccatcgttc
aaggcatgtgaggagaagaagaagaaccacaaggtggggacctccttccaccaggcctac
cgggagcgccattccaatgtcgatggtggccaccactcaaccatgcatgacctgctcttc
gggagccaggctgggcccgagcagttctcagcctgggtggcctcactgcaggacagccct
ggcctggtggactacacgctggagcctctgcacatgcttgtggagagccaggacccgcgg
cgggaggccctcaggcaggccgtgagcaagtacgtgactgacagggcacgctggagggac
tgcaaccgcccgtgccccccggggcaacacaagaacccgaagaacccatgccagtgcatr
tgtcctggttcagcagccaccacccaggactgctgtccccggcagargggactggcccac
ctggaggtcatgaacttcaaggcatcaggtctgtggggagactggatcactgccacggac
gcctatctgaaggtcttcttcgccggccaggagcagaggaccgccacagtatggaacgat
aacaaccccaggtggatgacgcggctggacttcggggatgtgctcctggccaccgggggc
cccctgagggtgcaggtctgggatgcagactctggctgggacgatgaccttcttggcact
tgtgaccgcaccccaaagtctggctcacatgaggtgtcgtgccccatggaccacggtctc
ctgaaattctcctaccaggtcaaatgcttgcctcacctgacgggggagaggtgcctgcag
tatgccccccaagggcttctggggaatcctccaggaaaccggagtgggccagtgtggtga

DBGET integrated database retrieval system