KEGG   Bos indicus (zebu cattle): 109554136
Entry
109554136         CDS       T04792                                 

Gene name
CTSF
Definition
(RefSeq) cathepsin F
  KO
K01373  cathepsin F [EC:3.4.22.41]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04142  Lysosome
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109554136 (CTSF)
  09143 Cell growth and death
   04210 Apoptosis
    109554136 (CTSF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109554136 (CTSF)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.41  cathepsin F
     109554136 (CTSF)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C1: papain family
   109554136 (CTSF)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 109554136
NCBI-ProteinID: XP_019810004
Position
29
AA seq 424 aa
MAPWLQLLARWGCGPHEGWTDKRVAVPSLTRPSVQAGRGSLYSLKATLVEPPCNDPTVCQ
LPVSKKTLLCSFEVLDELGKHMLLRRDCGPVDTKTTDDRNETFSSFLPLLNKDPLPQDFS
VKMASIFKDFVTTYNRTYDSQEEASWRMSVFANNMVRAQKIQALDRGTARYGVTKFSDLT
EEEFRTIYLNPLLKDAPGRNMRPAHPVTDVPPPQWDWRNKGAVTNVKDQGMCGSCWAFSV
TGNVEGQWFLKRGTLLSLSEQELLDCDKTDKACLGGLPSNAYSAIRTLGGLETEDDYSYR
GRLQTCSFSAEKAKVYINDSVELSKNEQKLAAWLAKNGPVSIAINAFGMQFYRHGISHPL
RPLCSPWLIDHAVLLVGYGNRSAIPFWAIKNSWGTDWGEEGYYYLHRGSGACGVNIMASS
AVIN
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcaccctggctgcagctgctggcacggtggggctgtgggccccatgaaggctggaca
gataagagggtggccgtgccgtcactcactcgcccttccgtccaggcgggccgggggtcc
ctgtactcgctgaaggcgaccctggtggagccgccctgcaacgaccccacggtgtgccag
ctcccggtgtccaagaagaccctgctctgcagcttcgaagtcctagacgagctaggaaaa
cacatgctactgaggcgggactgtggcccagtcgacaccaagactacagatgacagaaat
gagactttcagttcattccttccgctgctgaacaaggatcccctcccccaggacttttct
gtgaagatggcttcgatcttcaaggactttgtcaccacctataaccggacatatgattcg
caggaagaagccagttggcgcatgtccgtctttgccaataatatggtgcgagcgcagaag
atccaggccctggaccgtggcacagctcggtatggggtcaccaagttcagtgacctgaca
gaggaggagttccgcaccatctacctgaatcccctcctgaaagatgcgcctggcaggaac
atgcgcccggcccatcctgtcaccgacgttcctccgcctcagtgggactggaggaataag
ggggctgtcaccaatgtcaaggaccagggtatgtgcggctcctgctgggccttctcagtc
acaggcaacgtggagggccagtggttcctcaaacgggggaccctgctctccctgtctgag
caggagctcttggactgtgacaagactgacaaggcctgcctgggcggcttgccctctaac
gcctactcggccatacggactctgggagggctggagacggaggatgactacagctaccga
ggccgcttgcagacctgcagcttctctgcagagaaggccaaggtctacatcaacgactca
gtggagctgagcaagaatgagcaaaagctggcggcctggctggccaagaacggccccgtc
tccattgccatcaacgcctttggcatgcagttctaccgccacgggatctcccaccccctg
cgccccctctgcagcccttggctcatcgaccatgccgtgctgctcgtgggctatggcaac
cgctctgccatccccttctgggccatcaagaacagctggggcactgactggggtgaggag
ggttactactacttgcaccgtggctccggggcctgtggcgtgaacatcatggccagctca
gcggtgataaactga

KEGG   Bos indicus (zebu cattle): 109554360
Entry
109554360         CDS       T04792                                 

Gene name
CTSC
Definition
(RefSeq) dipeptidyl peptidase 1 isoform X1
  KO
K01275  cathepsin C [EC:3.4.14.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04142  Lysosome
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109554360 (CTSC)
  09143 Cell growth and death
   04210 Apoptosis
    109554360 (CTSC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109554360 (CTSC)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:biu03110]
    109554360 (CTSC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109554360 (CTSC)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.1  dipeptidyl-peptidase I
     109554360 (CTSC)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C1: papain family
   109554360 (CTSC)
Chaperones and folding catalysts [BR:biu03110]
 Intramolecular chaperones
  Papain family
   109554360 (CTSC)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109554360 (CTSC)
SSDB
Motif
Pfam: Peptidase_C1 CathepsinC_exc Peptidase_C1_2 Propeptide_C1
Other DBs
NCBI-GeneID: 109554360
NCBI-ProteinID: XP_019810343
Position
29
AA seq 463 aa
MGPWSGSRLVALLLLVYGAGSVRGDTPANCTYPDLLGTWVFQVGSSGSQRDVNCSVMGPP
EKKVVVHLKKLDTAYDDFGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGGKVTSYCHE
TMTGWVHDVLGRNWACFTGRKTGNTSENVNVNTARLAGLEETYSNRLYRYNHDFVKAINX
IQKSWTAAPYMEYETLTLKEMIRRGGGHSRRIPRPKPAPITAEIQKKILHLPTSWDWRNV
HGINFVTPVRNQGSCGSCYSFASMGMMEARIRILTNNTQTPILSPQEVVSCSQYAQGCEG
GFPYLIAGKYAQDFGLVEEDCFPYTGTDSPCRLKEGCFRYYSSEYHYVGGFYGGCNEALM
KLELVHQGPMAVAFEVYDDFLHYRXGVYHHTGLRDPFNPFELTNHAVLLVGYGTDAASGL
DYWIVKNSWGTSWGENGYFRIRRGTDECAIESIALAATPIPKL
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgggtccctggtccggctcgcggctcgtcgctctcttgctgctcgtctatggcgctggc
tccgtgcgcggggacacgcctgccaactgcacctaccccgacctgctgggcacctgggtc
ttccaggtgggctccagcggctcccagcgcgatgtcaactgctcggtgatgggaccccca
gaaaaaaaagtggtggtgcacctcaagaagttggatacagcatatgatgactttggcaat
tccggccatttcacyatcatttacaatcaaggctttgagattgtgttgaatgactacaag
tggttcgccttttttaagtataaagaagagggtggcaaggtaaccagttactgccacgag
accatgactggctgggtccatgacgtgctgggccggaactgggcctgtttcactggaagg
aagacaggaaatacctcggagaacgtgaacgtgaacacagcacgccttgcgggtctcgag
gaaacgtattctaataggctctacagatataaccatgactttgtgaaagctatcaatrcc
attcagaagtcttggactgcagccccatacatggaatatgagactcttaccctaaaagag
atgattaggagaggtggtggccatagccggagaattccaaggcccaaacctgcaccaatc
actgctgaaatacagaaaaagattttgcatttgccaacatcctgggattggagaaacgtt
catggtatcaattttgttactcctgttcgaaaccaagggtcttgtggaagctgctactca
tttgcttctatggggatgatggaagcaagaatccgcatactaaccaacaacactcagacc
ccgatcttgagtcctcaggaggttgtgtcttgcagtcagtatgctcaaggctgtgaaggt
ggcttcccttacctcatcgcagggaagtatgcccaggactttgggttggtggaagaggac
tgtttcccctacacaggcacggattcgccatgcagactgaaagagggctgcttccggtac
tattcctccgagtaccactacgtgggcggtttctacgggggctgcaatgaagccctgatg
aagcttgagctggtccatcaggggcccatggctgtcgcctttgaagtctacgacgacttc
ctccactaccgcragggcgtctaccaccacacrgggctgcgagaccctttcaaccccttc
gagctgaccaatcacgctgtgctgctggtgggctatggcactgacgcggcctctggactg
gattactggattgttaaaaacagctggggcaccagctggggtgagaacggttacttccgc
atccgcagaggaaccgacgagtgtgcgatcgaaagcatagcgctggcggccaccccgatt
cctaagttgtag

KEGG   Bos indicus (zebu cattle): 109554428
Entry
109554428         CDS       T04792                                 

Gene name
CTSD
Definition
(RefSeq) cathepsin D
  KO
K01379  cathepsin D [EC:3.4.23.5]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04071  Sphingolipid signaling pathway
biu04140  Autophagy - animal
biu04142  Lysosome
biu04210  Apoptosis
biu04915  Estrogen signaling pathway
biu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    109554428 (CTSD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109554428 (CTSD)
   04140 Autophagy - animal
    109554428 (CTSD)
  09143 Cell growth and death
   04210 Apoptosis
    109554428 (CTSD)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    109554428 (CTSD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109554428 (CTSD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109554428 (CTSD)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109554428 (CTSD)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.5  cathepsin D
     109554428 (CTSD)
Peptidases and inhibitors [BR:biu01002]
 Aspartic peptidases
  Family A1: pepsin family
   109554428 (CTSD)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109554428 (CTSD)
SSDB
Motif
Pfam: Asp TAXi_N A1_Propeptide TAXi_C
Other DBs
NCBI-GeneID: 109554428
NCBI-ProteinID: XP_019810480
Position
29
AA seq 412 aa
MQTPRLLPLLLALGLLAAPAAAVIRIPLHKFTSIRRTMSEAMGPVEHLIAKXPISKYATG
EPAVRQGPIPELLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSANLWVPSIHCKLLDIACW
THRKYNSDKSSTYVKNGTTFDIHYGSGSLSGYLSQDTVSVPCNPSSSSPAGVTVQRQTFG
EAIKQPGVVFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDKNVFSFFLNRDPKAQ
PGGELMLGGTDSKYYRGSLMFHNVTRQAYWQIHMDQLDVGSSLTVCKGGCEAIVDTGTSL
IVGPVEEVRELQKAIGAVPLIQGEYMIPCEKVSSLPQVTVKLGGKDYALSPEDYALKVSQ
AGTTVCLSGFMGMDIPPPGGPLWILGDVFIGRYYTVFDRDQNRVGLAEAARL
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgcagacgcccagactgctgccgctgctgctcgccctcggcctgctggccgcgcccgcc
gccgcggtcatcaggatcccactgcacaagttcacgtccatccgccggaccatgtcggag
gccatgggccccgtggaacacctgatcgccaagrgccccatctcgaagtatgccactggg
gagcctgctgtgaggcaggggccaattcccgagctgctcaagaactacatggatgcccag
tactacggggagatcggcatcgggacgcccccgcagtgcttcacagtcgtcttcgacacc
ggctctgccaacctgtgggtcccgtccatccactgcaagctgctggacatcgcctgctgg
acccaccgcaaatacaacagcgacaagtccagcacctacgtgaagaacggcacgaccttc
gacatccactacggctcgggcagcctctcggggtacctgagccaggacactgtgtcggta
ccctgtaacccatcctcgtccagcccggctggcgtcacggtgcagaggcagaccttcggg
gaggccatcaagcagcctggtgtggtcttcatcgcggccaagttcgacggcattctgggc
atggcctacccccgcatctccgtcaacaacgtgctgcctgtcttcgacaacctgatgcag
cagaagttggtggacaagaacgtcttctccttcttcctgaacagggacccgaaagcccag
cccgggggcgagctgatgctgggcgggaccgactccaagtactacagaggcagcctgatg
ttccacaacgttacccgccaggcctactggcagatccacatggaccagctggatgtgggc
agcagtctgaccgtgtgcaagggaggctgtgaggctatcgtggacacaggcacgtccctg
atcgtgggccctgtggaggaggtgcgggagctgcagaaggccatcggggccgtgccgctg
atacagggcgagtacatgatcccctgcgagaaggtgtccagcctgcctcaggtcaccgtg
aaactggggggtaaggactacgcgctgtccccagaggactacgcgctcaaggtgtcgcag
gccggcacgaccgtgtgcctgagcggcttcatgggcatggacatccccccgcctggcggg
ccgctctggatcctgggcgacgtcttcatcgggcgttactacaccgtgttcgaccgggac
cagaaccgggtgggcttggccgaggctgcccggctctag

KEGG   Bos indicus (zebu cattle): 109554432
Entry
109554432         CDS       T04792                                 

Gene name
CTSW
Definition
(RefSeq) cathepsin W
  KO
K08569  cathepsin W [EC:3.4.22.-]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04142  Lysosome
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109554432 (CTSW)
  09143 Cell growth and death
   04210 Apoptosis
    109554432 (CTSW)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109554432 (CTSW)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     109554432 (CTSW)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C1: papain family
   109554432 (CTSW)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29
Other DBs
NCBI-GeneID: 109554432
NCBI-ProteinID: XP_019810493
Position
29
AA seq 374 aa
MAPTVHLSCLLALLVAGLAQGIKDSLRGQDPGPQPLELKEVFRLFQMQYNRSYPNPAEYA
RRLDIFAQNLAKAQRLQEEDLGTAEFGVTQFSDLTEEEFVQLYGSQVAGEALGVSRKVGS
EEWGESEPQTCDWRKVGTISPVRDQRNCNCCWAMAAAGNIEALWAIKFRDFVEVSVQQLL
DCDRCGNGCRGGFVWDAFLTVLNNSGLASEKDYPFDGSGKTHRCLAKKYKKVVWIQDFII
LQACEQSMARHLATEGPITVTINMKLLQQYQKGVIKATPTTCDPTXVDHSVLLVGFGKTK
XVEGRQGKAASFGSYARPRRSMAYWTLKNSWGPQWGEEGYFRLHRGSNTCGITKFPVTAR
VDKPKKQHQVSCPP
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcaccaactgtccatctctcctgcctcctggccctgctggtggcaggcctggctcaa
ggcatcaaggactccctcaggggccaggacccaggtccccagccactggagctgaaagag
gtcttcagattgtttcagatgcagtacaaccggagttatccaaatccagcagagtacgcc
cgccgcctggacatctttgcccaaaacctggccaaggctcagcggctgcaggaggaggac
ctgggcacagccgagtttggggtgactcaattcagtgacctcacagaggaggagtttgtc
cagctttatggaagccaggtggctggagaggccctcggtgtgagtagaaaagtggggtct
gaagagtggggggaatcagagccccagacctgtgactggcggaaagttggcaccatctca
cccgtcagggaccagcgaaactgcaactgctgctgggccatggcggcagcgggcaacatc
gaggccctatgggccatcaagttcagagacttcgtggaggtctccgtgcagcagctgctt
gactgtgaccgctgtgggaacggctgcaggggtggcttcgtctgggatgcgttcctcact
gtcctcaacaacagcggcctggccagtgagaaggactatccattcgatgggagtggcaaa
acccacaggtgcctggctaagaagtacaagaaggtggtctggatccaggatttcataata
ctgcaggcctgcgagcagagcatggccaggcacttggccaccgagggccccatcaccgtg
accatcaatatgaagctactgcagcaataccagaagggtgtgatcaaggccacacctacc
acctgtgaccccacacwagtggatcattctgtcctgctggtgggttttggtaaaaccaag
tyggtggaggggaggcaggggaaggcggcctcgttcggatcctacgcgcgccctcgccgc
tccatggcatactggaccctgaagaactcctgggggcctcagtggggtgaggagggctat
ttccggctgcatcgagggagtaacacctgcggcatcaccaagttcccggtcaccgccaga
gtggacaagcctaagaagcagcaccaagtctcttgccctccctga

KEGG   Bos indicus (zebu cattle): 109555331
Entry
109555331         CDS       T04792                                 

Gene name
CTSK
Definition
(RefSeq) cathepsin K
  KO
K01371  cathepsin K [EC:3.4.22.38]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04142  Lysosome
biu04210  Apoptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109555331 (CTSK)
  09143 Cell growth and death
   04210 Apoptosis
    109555331 (CTSK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109555331 (CTSK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109555331 (CTSK)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    109555331 (CTSK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109555331 (CTSK)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:biu03110]
    109555331 (CTSK)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.38  cathepsin K
     109555331 (CTSK)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C1: papain family
   109555331 (CTSK)
Chaperones and folding catalysts [BR:biu03110]
 Intramolecular chaperones
  Papain family
   109555331 (CTSK)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 109555331
NCBI-ProteinID: XP_019811697
Position
3
AA seq 334 aa
MPINRMWGLTVLLLPVVSFALYPEEILDTQWELWKKTYRKQYNSKGDEISRRLIWEKNLK
HISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPASRSRSNDTLYIPDWEGRA
PDSIDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSEND
GCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQDENCMYNPTGKAAKCRGYREIPEGNEKAL
KRAVARVGPISVAIDASLTSFQFYRKGVYYDENCNSDNLNHAVLAVGYGIQKGNKHWIIK
NSWGENWGNKGYILMARNKNNACGIANLASFPKM
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgcccatcaacaggatgtggggtctcacggttctactgctgcctgtggtgagctttgct
ctataccctgaggagatactggacacccagtgggagctatggaagaagacctacagaaag
cagtataacagcaagggggatgagatctctcggcgtttaatttgggaaaaaaacctgaag
catatttccatccataatcttgaggcctcacttggtgtccatacatatgaactggccatg
aaccacttgggggacatgaccagtgaagaagtggttcagaagatgactggactcaaagta
cccgcttctcgttcccgcagtaatgacaccctctatatcccagactgggaaggcagagcc
ccagactctattgattatcggaagaagggatacgttactcctgtcaaaaaccagggtcag
tgtggttcctgttgggcttttagctctgtgggtgccctggagggccaactcaagaagaaa
accggcaaactcttaaatctgagtcctcagaacctggtggactgtgtgtctgagaatgat
ggctgtggagggggctatatgaccaatgccttccagtatgtgcagaagaaccgaggcatt
gactctgaagatgcctacccatatgttggacaggatgaaaattgtatgtacaatccaaca
ggcaaggcagctaagtgcagaggatacagagagatccccgaaggaaatgaaaaagccctg
aagagggcagtagcccgagtgggacccatctctgtggccattgatgcaagcctgacctcc
ttccagttttacagaaaaggtgtgtattacgatgaaaactgcaatagcgataatctcaac
cacgcggttttggcagtgggatatgggatccagaaggggaacaagcactggataattaaa
aacagctggggagaaaactggggaaacaaaggctatatcctcatggcccggaataagaac
aacgcttgtggcattgccaacctggccagcttccccaagatgtga

KEGG   Bos indicus (zebu cattle): 109555340
Entry
109555340         CDS       T04792                                 

Gene name
CTSS
Definition
(RefSeq) cathepsin S
  KO
K01368  cathepsin S [EC:3.4.22.27]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04142  Lysosome
biu04145  Phagosome
biu04210  Apoptosis
biu04612  Antigen processing and presentation
biu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109555340 (CTSS)
   04142 Lysosome
    109555340 (CTSS)
  09143 Cell growth and death
   04210 Apoptosis
    109555340 (CTSS)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    109555340 (CTSS)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109555340 (CTSS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109555340 (CTSS)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:biu03110]
    109555340 (CTSS)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.27  cathepsin S
     109555340 (CTSS)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C1: papain family
   109555340 (CTSS)
Chaperones and folding catalysts [BR:biu03110]
 Intramolecular chaperones
  Papain family
   109555340 (CTSS)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 109555340
NCBI-ProteinID: XP_019811706
Position
3
AA seq 331 aa
MNWLVWALLLCSSAMAHVHRDPTLDHHWDLWKKTYGKQYKEKNEEVARRLIWEKNLKXVT
LHNLEHSMGMHSYELGMNHLGDMTSEEVISLMSSLRVPSQWPRNVTYKSDPNQKLPDSMD
WREKGCVTEVKYQGACGSCWAFSAVGALEAQVKLKTGKLVSLSAQNLVDCSTAKYGNKGC
NGGFMTEAFQYIIDNNGIDSEASYPYKAMDGKCQYDVKNRAATCSRYIELPFGSEEALKE
AVANKGPVSVGIDASHSSFFLYKTGVYYDPSCTQKVNHGVLVVGYGNLDGKDYWLVKNSW
GLHFGDQGYIRMARNSGNHCGIANYPSYPEI
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaactggctggtgtgggcactcctgctgtgctcctctgcaatggcacatgtgcacaga
gaccccactctggatcatcactgggatctctggaagaaaacctatggaaaacaatacaaa
gaaaagaatgaggaagtagcacggcgtctcatctgggaaaagaatctaaaaaytgttaca
cttcacaatctggagcattcaatgggaatgcattcatatgagctaggcatgaaccaccta
ggagacatgaccagtgaagaagtgatatctttaatgagttccttgagagttcccagccaa
tggccaagaaatgtcacttacaagtcagaccctaatcagaaattgcctgattctatggac
tggagagagaaggggtgtgttactgaagtgaaataccagggtgcttgtggttcttgctgg
gctttcagtgctgtgggagccctggaagcacaagtgaagctgaaaacaggaaagctggtg
tctctgagtgcacagaacctggtggattgctcaactgcaaaatatgggaataaaggctgc
aatggcggcttcatgacagaggctttccaatatatcattgacaacaatggcatcgattca
gaagcttcctatccctacaaagccatggatggaaagtgccagtatgatgtaaaaaatcga
gctgccacgtgttcaaggtatattgaacttcccttcggcagcgaagaggccttaaaagaa
gccgtggccaataaaggacctgtgtctgttggtatagacgcgagccattcttctttcttc
ctctacaaaactggtgtctactatgacccctcctgcactcagaaagtgaaccatggtgta
ctcgtggttggctatggtaaccttgacgggaaggactactggcttgtgaaaaacagctgg
ggcctgcactttggtgaccaaggatatatacggatggcaagaaatagtggaaatcactgt
gggattgctaattatccttcttacccagaaatctag

KEGG   Bos indicus (zebu cattle): 109562776
Entry
109562776         CDS       T04792                                 

Gene name
CTSB
Definition
(RefSeq) cathepsin B isoform X1
  KO
K01363  cathepsin B [EC:3.4.22.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04140  Autophagy - animal
biu04142  Lysosome
biu04210  Apoptosis
biu04612  Antigen processing and presentation
biu04621  NOD-like receptor signaling pathway
biu04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109562776 (CTSB)
   04140 Autophagy - animal
    109562776 (CTSB)
  09143 Cell growth and death
   04210 Apoptosis
    109562776 (CTSB)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109562776 (CTSB)
   04612 Antigen processing and presentation
    109562776 (CTSB)
  09152 Endocrine system
   04924 Renin secretion
    109562776 (CTSB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109562776 (CTSB)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:biu03110]
    109562776 (CTSB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109562776 (CTSB)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109562776 (CTSB)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     109562776 (CTSB)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C1: papain family
   109562776 (CTSB)
Chaperones and folding catalysts [BR:biu03110]
 Intramolecular chaperones
  Papain family
   109562776 (CTSB)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   109562776 (CTSB)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Others
   109562776 (CTSB)
SSDB
Motif
Pfam: Peptidase_C1 Propeptide_C1 Peptidase_C1_2
Other DBs
NCBI-GeneID: 109562776
NCBI-ProteinID: XP_019821350
Position
8
AA seq 335 aa
MWRLLATLSCLLVLTSARSSLYFPPLSDELVNFVNKQNTTWKAGHNFYNVDLSYVKKLCG
AILGGPKLPQRDAFAADVVLPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDR
ICIHSNGRVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGLYNSHVGCR
PYSIPPCEHHVNGSRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIM
AEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGVENGTPYWLVGNSW
NTDWGDNGFFKILRGQDHCGIESEIVAGMPCTHQY
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgtggcggctcttggccaccctcagctgcctgctggtgctgaccagtgcccggagcagc
ctgtatttcccgcctctgtccgatgagctggtcaactttgttaacaagcaaaacaccact
tggaaggctggacacaacttctacaacgtggacctgagctatgtgaagaagctgtgtggc
gccatcctgggcgggcccaagctgccccagagagatgcatttgctgcggatgtggttctg
cctgaaagcttcgatgcccgggaacagtggccaaactgcccgaccatcaaagagatcaga
gaccagggatcctgtggctcctgctgggcgttcggggctgtggaagccatttctgaccgg
atctgcatccacagcaatgggcgtgtcaacgtggaggtgtccgctgaggacatgctgacc
tgctgtggtggcgagtgtggggacggctgtaacggcggcttcccctctggagcctggaac
ttctggacaaagaaaggcttagtgtccgggggcctctataactcgcatgtaggttgcaga
ccgtactccatccctccctgtgagcaccatgtgaacggctcccggcccccgtgcaccggt
gagggggacacccccaagtgcagcaagacctgtgagcccggctacagtccgtcctacaaa
gaagacaagcattttggatgcagttcctacagcgtcgccaacaacgagaaggagatcatg
gcagagatctacaaaaatggcccagtcgagggggccttctctgtgtactcggacttcctg
ctatacaagtctggggtgtaccagcacgtctctggagagattatgggaggccacgccatc
cgcatcctaggctggggagtggagaacggcaccccctactggctggtcggcaactcctgg
aacactgattggggtgacaatggcttcttcaaaatcctcagaggacaggaccactgtgga
atcgagtcggaaattgtggctggaatgccgtgcactcatcaatactag

KEGG   Bos indicus (zebu cattle): 109563231
Entry
109563231         CDS       T04792                                 

Gene name
CTSL
Definition
(RefSeq) cathepsin L1
  KO
K01365  cathepsin L [EC:3.4.22.15]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04140  Autophagy - animal
biu04142  Lysosome
biu04145  Phagosome
biu04210  Apoptosis
biu04612  Antigen processing and presentation
biu05205  Proteoglycans in cancer
biu05323  Rheumatoid arthritis
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109563231 (CTSL)
   04142 Lysosome
    109563231 (CTSL)
   04140 Autophagy - animal
    109563231 (CTSL)
  09143 Cell growth and death
   04210 Apoptosis
    109563231 (CTSL)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    109563231 (CTSL)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109563231 (CTSL)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109563231 (CTSL)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109563231 (CTSL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109563231 (CTSL)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:biu03110]
    109563231 (CTSL)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109563231 (CTSL)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.15  cathepsin L
     109563231 (CTSL)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C1: papain family
   109563231 (CTSL)
Chaperones and folding catalysts [BR:biu03110]
 Intramolecular chaperones
  Papain family
   109563231 (CTSL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Others
  109563231 (CTSL)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2 Styelin Meiosis_expr
Other DBs
NCBI-GeneID: 109563231
NCBI-ProteinID: XP_019822091
Position
8
AA seq 367 aa
MGGLGAHNPTLDAPGSGAAGCACAAGSPRHRFLNMNPSLLLTALCLGIASAAPKFDHSLD
TQWKXWKATHRKPYDLNEEGWRKAVWKKNMKMIELHNQEYSQGKHSFSMAMNAFGDMTNE
EFRHTMNGFQRQKNKKGKEFHETIFASIPPSVDWREKGYVTPVKNQGKCGSCWAFSATGA
LEGQMFQKTGKLVSLSEQNLVDCSQPQGNRGCHGGFIDNAFQYVLDVGGLDSEESYPYTG
LVGTCLYNPNNSAANETGFVDLPKQEKALMKAVATLGPISVAVDAHNPSFQFYKSGIYYE
PNCSSESVDHAVLVVGYGFEGADSDDNKYWLVKNSWGEHWGMNGYIKMAKDRNNHCGIAT
MASYPTV
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgggaggtcttggtgcccacaacccaactttagacgccccgggatccggagccgcaggt
tgtgcctgtgcggcaggcagccctcgccacaggtttttgaacatgaatccttcactcctc
ctgacagccctttgcttgggaatagcctcagctgctccaaaatttgaccacagtttagat
acacaatggaaatygtggaaggcaacacacaggaaaccatacgacttgaatgaagaagga
tggagaaaagccgtgtggaagaagaatatgaaaatgattgagctgcataatcaggaatac
agccaagggaaacatagcttcagcatggcaatgaatgcctttggtgacatgaccaatgaa
gaattcaggcacacgatgaatggctttcaaaggcagaagaacaagaaggggaaagagttc
catgaaactatctttgcttcgattcctccatccgtggattggagagagaaaggctatgta
actcctgtgaagaatcagggtaaatgtggttcttgttgggcttttagtgccacgggtgct
cttgaaggacagatgttccaaaaaactggcaaacttgtttcactgagtgagcagaacctg
gtggactgctctcagcctcaaggcaatcggggttgtcacggtggcttcatagataatgcc
ttccagtatgttttggacgttggaggcctggactcagaggaatcttatccatacactgga
ttggttggcacctgcctttacaatcccaacaattctgctgctaatgaaactggtttcgtg
gacctccctaagcaggagaaggctcttatgaaggcagtggcaactttgggtcccatctct
gttgctgtagatgcacacaatccatctttccagttctacaagtcaggcatttattatgag
ccaaattgtagcagtgaatccgtggatcatgctgttctggtagttggctatggctttgaa
ggagcagactcagatgacaataaatattggcttgtcaaaaacagctggggtgaacattgg
ggcatgaatggctacataaagatggccaaagaccggaacaaccactgtggaatcgccacc
atggccagttatcctactgtctaa

KEGG   Bos indicus (zebu cattle): 109567290
Entry
109567290         CDS       T04792                                 

Gene name
CTSZ
Definition
(RefSeq) cathepsin Z isoform X1
  KO
K08568  cathepsin X [EC:3.4.18.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04142  Lysosome
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109567290 (CTSZ)
  09143 Cell growth and death
   04210 Apoptosis
    109567290 (CTSZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109567290 (CTSZ)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.18  Cysteine-type carboxypeptidases
    3.4.18.1  cathepsin X
     109567290 (CTSZ)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C1: papain family
   109567290 (CTSZ)
SSDB
Motif
Pfam: Peptidase_C1 Peptidase_C1_2
Other DBs
NCBI-GeneID: 109567290
NCBI-ProteinID: XP_019827672
Position
13
AA seq 304 aa
MASSGPLVPPLLLLLVLLAGAARAGLHFRPGRSCYRPLRGDRLTQLGRRTYPRPHEYLSP
SDLPKSWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSAMADRINIKRKGAWPSTLLS
VQHVIDCGDAGSCEGGNDLPVWEYAHRHGIPDETCNNYQAKDQECDKFNQCGTCTEFKEC
HVIKNYTLWKVGDYGSLSGREKMMAEIYTNGPISCGIMATEKMSNYTGGIYSEYNDQAFI
NHIVSVAGWGVSDGMEYWIVRNSWGEPWGEHGWMRIVTSTYKGGEGARYNLAIEESCTFG
DPIV
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgtcgtccgggccgctggtgcctccgctgctgctgctgctcgtgctgctggcgggc
gcggcgcgggccggcctccacttccgaccgggccgaagctgctaccggcctcttcgggga
gaccggctcacccaactggggcgcaggacgtacccccggcctcatgagtacctgtccccg
tcggatctccccaagagctgggactggcgcaatgtgaatggggtcaactacgccagtgtc
accagaaaccagcacatcccccagtactgtggctcctgctgggcgcatggcagcaccagt
gccatggcggaccggatcaacatcaagaggaagggggcgtggccgtccacactgttgtcg
gtgcagcacgtgatcgactgtggcgacgcgggctcttgtgaggggggcaacgacctgccg
gtgtgggagtatgcccaccgkcacggcatccccgacgagacctgcaacaactaccaggcc
aaggaccaagagtgtgacaagtttaaccagtgtgggacgtgcactgaattcaaagagtgc
catgtcatcaagaactacaccctctggaaggtcggtgactacggctccctttcggggagg
gagaagatgatggcagaaatctacaccaacggccccatcagctgtggcataatggcaacc
gaaaagatgtctaactacactggtggcatctactccgaatacaacgaccaggccttcata
aaccacatcgtctccgtggccgggtggggtgtcagcgatggcatggagtactggattgtc
cggaactcgtggggagaaccatggggcgagcacggctggatgcggatcgtgaccagcacc
tacaaaggtggggagggcgcccgttacaacctggccatcgaggagagctgcacgtttggg
gaccccattgtttaa

KEGG   Bos indicus (zebu cattle): 109571466
Entry
109571466         CDS       T04792                                 

Gene name
CTSO
Definition
(RefSeq) cathepsin O
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04142  Lysosome
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109571466 (CTSO)
  09143 Cell growth and death
   04210 Apoptosis
    109571466 (CTSO)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109571466 (CTSO)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     109571466 (CTSO)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C1: papain family
   109571466 (CTSO)
SSDB
Motif
Pfam: Peptidase_C1 Peptidase_C1_2
Other DBs
NCBI-GeneID: 109571466
NCBI-ProteinID: XP_019833522
Position
17
AA seq 313 aa
MELRRLWLLCCCCCFYCWGSCAALTPPFGRHPAAAFRESLNRQRYLNSLFPYENSTAVYG
INQFSYLFPEEFKAIYLRSSPSRFPRFPAEEYTSISNLSLPLRFDWRDKHVVTQVRNQKT
CGGCWAFSVVGAVESVCAIKGQPLEVLSVQQVIDCSYSNYGCNGGSPLSALYWLNKLQVK
LVRDSEYPFQAQNGLCRYFSDSHSGSSIKGYSAYDFSGQEDKMAEALLALGPLIVVVDAM
SWQDYLGGIIQHHCSSGEANHAVLVTGFDKTGSIPYWIVRNSWGXSWGIDGYVRVKMGGN
VCGIADSVSAVFV
NT seq 942 nt   +upstreamnt  +downstreamnt
atggagctgcggcgcctctggctgctctgctgctgctgctgcttctactgctggggctcc
tgcgccgcgctgaccccgccgttcggccgccaccccgccgccgccttccgggaaagtctt
aatagacagcgatacttgaattctttatttccttatgaaaactccactgccgtctatgga
ataaaccagttttcatatttgtttcctgaagagtttaaagctatttatttaagaagcagc
ccttccaggtttccccgatttccggcagaagagtacacatccatctccaacctgtctttg
ccgttaagatttgactggagggataagcacgtcgtcacccaagtgagaaaccagaagacg
tgtggtggatgctgggctttcagcgtggtgggtgcagtggagtctgtgtgtgcgataaaa
gggcagcccttggaggtgctgagtgttcagcaggtgatagactgttcttatagcaactac
ggctgcaacggaggatccccgctcagcgctttgtactggctcaataagctgcaagtcaag
ctggtgagagattcggaatacccatttcaagcccagaatggcctctgccgttacttttcc
gactcacattctggatcttcaatcaaaggttattctgcgtatgacttcagtggccaagaa
gacaaaatggcagaagcacttttggccttgggacctctgatagtggtggtagatgccatg
agctggcaagactacctgggaggcattatacagcaccactgctccagtggagaagcaaat
cacgccgtccttgtaacgggctttgataaaacgggaagtatcccatactggattgtacgg
aactcctggggaayttcatggggcatcgatggctatgtccgtgtgaaaatgggaggaaat
gtttgtggtattgcagattctgtttcggctgtattcgtgtaa

KEGG   Bos indicus (zebu cattle): 109575407
Entry
109575407         CDS       T04792                                 

Gene name
CTSH
Definition
(RefSeq) pro-cathepsin H
  KO
K01366  cathepsin H [EC:3.4.22.16]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04142  Lysosome
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109575407 (CTSH)
  09143 Cell growth and death
   04210 Apoptosis
    109575407 (CTSH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109575407 (CTSH)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.16  cathepsin H
     109575407 (CTSH)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C1: papain family
   109575407 (CTSH)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2 Imm40
Other DBs
NCBI-GeneID: 109575407
NCBI-ProteinID: XP_019839060
Position
21
AA seq 335 aa
MWAVLPLLCAGAWLLGAPACGAAELAANSLEKFHFQSWMVQHQKKYSSEEYYHRLQVFAS
NLREINAHNARNHTFKMGLNQFSDMSFDELKRKYLWSEPQNCSATKSNYLRGTGPYPPSM
DWRKKGNFVTPVKNQGSCGSCWTFSTTGALESAVAIATGKLPFLAEQQLVDCAQNFNNHG
CQGGLPSQAFEYIRYNKGIMGEDTYPYRGQDGDCKYQPSKAIAFVKDVANITLNDEEAMV
EAVALHNPVSFAFEVTADFMMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEEKGIPYWIVK
NSWGPNWGMKGYFLIERGKNMCGLAACASFPIPLV
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgtgggccgtcctgccgctgctctgcgcgggagcctggctcctgggcgccccggcttgc
ggcgccgccgagctggccgcgaactctttagagaagtttcactttcaatcatggatggtg
cagcatcaaaagaaatacagctcagaggagtactaccacaggctgcaggtgtttgccagc
aacttgagggagatcaacgcccacaacgccaggaaccacacatttaaaatgggactgaat
caattttcagacatgagctttgatgaattaaaacgcaagtatctttggtcagagcctcag
aattgctcagccaccaaaagtaactaccttcgaggtactggtccctacccaccctccatg
gactggcgaaaaaaaggaaattttgtcacaccagtgaaaaatcagggcagctgcggcagt
tgctggaccttctccaccaccggggccctggagtctgctgtcgccatagcaacagggaag
ttgcccttcctggctgagcagcagctggtggactgcgcccagaacttcaacaaccacggc
tgccaagggggtctccccagccaggccttcgagtacatccggtacaacaagggcatcatg
ggtgaagacacctacccctacaggggccaggatggtgactgcaagtaccagcccagtaag
gccattgcttttgtcaaggacgtagccaacatcacactgaacgatgaggaggcgatggta
gaggccgtggccctacacaaccccgtgagcttcgccttcgaggtgactgctgactttatg
atgtacagaaagggcatctactccagtacttcctgtcataagactccagataaagtaaac
cacgcagtgctggctgttgggtacggagaagagaaagggataccttactggatcgtgaag
aattcttggggccctaactggggaatgaaggggtacttcctcattgagcgcgggaagaac
atgtgcggccttgcggcctgtgcctccttccctatccccctggtgtga

DBGET integrated database retrieval system