KEGG   Bos indicus (zebu cattle): 109554379
Entry
109554379         CDS       T04792                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00100  Steroid biosynthesis
biu01100  Metabolic pathways
Module
biu_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    109554379 (TM7SF2)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     109554379 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 109554379
NCBI-ProteinID: XP_019810382
UniProt: A0A6P5BCN7
Position
29
AA seq 418 aa
MAPPQGSRAPLEFGGPLGAAALMLLLPVTMFHLLLVARSGPARLLGPPPYLPGLEELWSP
WALLLCLTWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTALLVGLGVSAG
LPLSALPEMLLPLAFAATLIAFIFSLLLYLKALLAPASALAPGGNSGNLIYDFFLGRELN
PRICSFDFKYFCELRPGLIGWVLINLALLIQEAELRGSPSLAMWLVNGFQLLYVGDALWY
EEAVLTTMDIIHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPQPLGWPLASFICLINAVG
YYIFRGANSQKNTFRKNPSDPRVADLETISTATGRRLLVSGWWGMVRHPNYLGDLIMALA
WSLPCGVFHLLPYFYFLYFTALLVHREDRDERQCRQKYGLAWHEYCRRVPYRIVPYVY
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcccctcctcagggctctcgggccccgctggaattcggaggacccttgggcgccgcg
gcactgatgctgctgctcccggtcactatgttccacctgctactggtggcccgctcgggc
ccggcgcgcctcctgggcccacccccctacctgccgggactggaggagctgtggagcccg
tgggcgctgttgctctgtctcacctggctcggcctgcaggcggcgctctacctcttgccg
gcgcgtaaggtggctgaggggcaggaattgaaggacaagagtcgactgcgctaccccatt
aacggcttccaggccctggtgctgacagccctcttggtgggcctgggggtgtcagccggg
ctgcccctgagcgcgctcccggaaatgctcttgcccttggcgtttgcggccaccctcatt
gccttcatcttcagcctccttctgtatctgaaggctctgctagcccctgcctcggccctg
gcacctggagggaactcaggcaatctcatttacgactttttcctgggacgggagctcaac
ccgcgcatctgttcctttgacttcaaatatttctgcgaactgcggcctggcctcatcggc
tgggtcctcatcaacctggcgttgctgatacaggaagcagaacttcgggggagtccctcg
ctggccatgtggctggtcaatggcttccagctactgtacgtgggtgatgccctttggtac
gaggaggcagtcctgaccaccatggacatcatccatgacgggtttggcttcatgctggcc
tttggggacctygcctgggtacccttcacctacagcctgcaggcccagttcctgctgtat
cacccacagcctctggggtggcccctggcctcattcatctgcctcatcaatgctgttggt
tactacatcttccgtggagccaattctcagaaaaacaccttccgaaagaatccttctgat
cccagagtggctgaccttgagaccatctctacagccacagggcgacggctgctggtgtcc
gggtggtggggtatggtccgccatcccaactaccttggagacctcatcatggctctggcc
tggtccttgccgtgtggggtgttccacctgctgccctacttctacttcctctacttcacc
gcgctgctggtgcaccgtgaggaccgggatgagaggcagtgtcggcagaagtacggcctg
gcctggcacgagtactgccggcgtgtgccctaccgaatcgtgccctacgtctactga

DBGET integrated database retrieval system