KEGG   Bos indicus (zebu cattle): 109554386
Entry
109554386         CDS       T04792                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04140  Autophagy - animal
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04370  VEGF signaling pathway
biu04510  Focal adhesion
biu04722  Neurotrophin signaling pathway
biu04910  Insulin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu05010  Alzheimer disease
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05165  Human papillomavirus infection
biu05168  Herpes simplex virus 1 infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05215  Prostate cancer
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05223  Non-small cell lung cancer
biu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109554386 (BAD)
   04014 Ras signaling pathway
    109554386 (BAD)
   04370 VEGF signaling pathway
    109554386 (BAD)
   04024 cAMP signaling pathway
    109554386 (BAD)
   04022 cGMP-PKG signaling pathway
    109554386 (BAD)
   04151 PI3K-Akt signaling pathway
    109554386 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109554386 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    109554386 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109554386 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    109554386 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109554386 (BAD)
   04919 Thyroid hormone signaling pathway
    109554386 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109554386 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109554386 (BAD)
   05203 Viral carcinogenesis
    109554386 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109554386 (BAD)
   05212 Pancreatic cancer
    109554386 (BAD)
   05225 Hepatocellular carcinoma
    109554386 (BAD)
   05221 Acute myeloid leukemia
    109554386 (BAD)
   05220 Chronic myeloid leukemia
    109554386 (BAD)
   05218 Melanoma
    109554386 (BAD)
   05211 Renal cell carcinoma
    109554386 (BAD)
   05215 Prostate cancer
    109554386 (BAD)
   05213 Endometrial cancer
    109554386 (BAD)
   05223 Non-small cell lung cancer
    109554386 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109554386 (BAD)
   05014 Amyotrophic lateral sclerosis
    109554386 (BAD)
   05020 Prion disease
    109554386 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109554386 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109554386 (BAD)
   05162 Measles
    109554386 (BAD)
   05161 Hepatitis B
    109554386 (BAD)
   05160 Hepatitis C
    109554386 (BAD)
   05168 Herpes simplex virus 1 infection
    109554386 (BAD)
   05165 Human papillomavirus infection
    109554386 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109554386 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109554386 (BAD)
   01524 Platinum drug resistance
    109554386 (BAD)
   01522 Endocrine resistance
    109554386 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 109554386
NCBI-ProteinID: XP_019810393
Position
29
AA seq 168 aa
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSH
HGGTGAVETRSRHSSYRAGPEDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSD
EFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggacaggcccccaggtctcagcaagcactggctaaca
gccccaggcctcctgggggaagctggtcaccagcaggggcagccggccggcagcagccac
catggaggcactggggctgtggagacccggagtcgtcacagctcctaccgcgcggggcca
gaggataatgaagagacggaggaggaggatctcggcccctttaggggccgctcgcgttcg
gcgccccccaacctctgggctgcacagcgatatggccgcgagctccggaggatgagcgac
gagtttcacgtctccttcaaggggcttcctcgcccgaagagcgcgggcacggcaacgcaa
atgcgacaaagccccagctggacgcgcttcctccagtcctggttgagccggaacttgggg
agaggaggctccgccccctcccagtga

DBGET integrated database retrieval system