KEGG   Bos indicus (zebu cattle): 109554436
Entry
109554436         CDS       T04792                                 

Gene name
CD86
Definition
(RefSeq) T-lymphocyte activation antigen CD86 isoform X1
  KO
K05413  CD86 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04620  Toll-like receptor signaling pathway
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05202  Transcriptional misregulation in cancer
biu05320  Autoimmune thyroid disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109554436 (CD86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109554436 (CD86)
   04672 Intestinal immune network for IgA production
    109554436 (CD86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109554436 (CD86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109554436 (CD86)
   05323 Rheumatoid arthritis
    109554436 (CD86)
   05320 Autoimmune thyroid disease
    109554436 (CD86)
   05330 Allograft rejection
    109554436 (CD86)
   05332 Graft-versus-host disease
    109554436 (CD86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109554436 (CD86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109554436 (CD86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    109554436 (CD86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109554436 (CD86)
   04090 CD molecules [BR:biu04090]
    109554436 (CD86)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109554436 (CD86)
CD molecules [BR:biu04090]
 Proteins
  109554436 (CD86)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 I-set ig Ig_6 C2-set_2 DUF4307 CcmH
Other DBs
NCBI-GeneID: 109554436
NCBI-ProteinID: XP_019810538
Position
1
AA seq 339 aa
MGTCDSTMGLRNTLIVMALLLSVSTVPFSGAASLKSHAFFNETGELPCHFPNTQNLSLDE
LVIFWQDQNKLVLYELFKGQEKPNNVNPKYIGRTSFDQDSWTLRLHNVQIKDTGSYQCFI
HHRRSQGLVSIHQMSSDLIVLANFSQPEIRLIANQTEKSNIINLTCSSIQGYPEPQRMYV
SLNTTNSSSTYDAVMKKSQSNITELYNVSISVSFPIPPETNVTIFCALQLEPTKIILSQP
YNIDAKSPVPSPPVPDHILWIAALLVTVVVSGMVFLTLKKRKKKQPGPSNECEIIKVEEK
ESEQTAKRVELQEPERSDEVQCDVNISKTASDNKSATBX
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgggcacctgtgacagcaccatgggactgcgaaacactctaatcgtgatggccctcctg
ctctctgtttccactgttcctttttcaggtgctgcttccttgaaaagtcatgccttcttc
aacgagactggagaactgccatgccactttccaaacacccaaaacctcagcctggacgaa
ctggtgatattttggcaggatcagaataagttggttctctatgagctattcaaaggccaa
gagaagcccaataatgttaatcccaagtatataggccgcacaagctttgaccaggacagt
tggaccttgagactccacaacgttcaaatcaaagacacaggctcgtatcaatgtttcatc
catcatagaaggtcccaaggattggtttccatccaccagatgagttctgacctgatagtg
ctggctaacttcagtcaaccagaaataagactaattgctaaccaaacagaaaagtctaac
atcatcaatttgacctgctcatctatacaaggttacccagaacctcagaggatgtatgtg
agtctaaacactacaaattcaagtagcacctatgatgctgtcatgaagaaatctcaaagt
aatatcacagaactatacaatgtttctatcagcgtgtcttttcccatccctcctgaaaca
aatgtgaccatattctgtgccctgcaacttgagccaacgaagataattttatcccaacct
tacaatatagatgcaaagtcacctgtgccaagcccccctgtcccagaccacatcctctgg
attgcagctctacttgtaacagtggtcgtgagtgggatggtgtttctaacactaaagaaa
aggaagaagaagcagcctggcccctctaatgaatgtgaaatcatcaaagtggaggagaaa
gagagtgaacagactgcgaaaagagtagaactccaagaacctgaaagatctgatgaagtc
cagtgtgatgttaacatttcaaagacagcctcagayaacaaaagcgctacaratttktaa

KEGG   Bos indicus (zebu cattle): 109576990
Entry
109576990         CDS       T04792                                 

Gene name
CD80
Definition
(RefSeq) T-lymphocyte activation antigen CD80
  KO
K05412  CD80 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04620  Toll-like receptor signaling pathway
biu04672  Intestinal immune network for IgA production
biu04940  Type I diabetes mellitus
biu05320  Autoimmune thyroid disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109576990 (CD80)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109576990 (CD80)
   04672 Intestinal immune network for IgA production
    109576990 (CD80)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109576990 (CD80)
   05323 Rheumatoid arthritis
    109576990 (CD80)
   05320 Autoimmune thyroid disease
    109576990 (CD80)
   05330 Allograft rejection
    109576990 (CD80)
   05332 Graft-versus-host disease
    109576990 (CD80)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109576990 (CD80)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109576990 (CD80)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109576990 (CD80)
CD molecules [BR:biu04090]
 Proteins
  109576990 (CD80)
SSDB
Motif
Pfam: C2-set_2 Ig_3 V-set ig Ig_2 I-set Ig_6
Other DBs
NCBI-GeneID: 109576990
NCBI-ProteinID: XP_019841255
Position
1
AA seq 296 aa
MGHTMKWGTLPPKRPCLWLSQLLVLTGLFYFCSGITPKSVTKRVKETVMLSCDYNTSTEE
LTSLRIYWQKDSKMVLAILPGKVQVWPEYKNRTITDMNDNPRIVILALRLSDSGTYTCVI
QKPDLKGAYKLEHLTSVRLMIRADFPVPTINDLGNPSPNIRRLICSTSGGFPRPHLYWLE
NGEELNATNTTLSQDPETKLYMISSELDFNMTSNHSFLCLVKYGDLTVSQTFYWQESKPT
PSANQHLTWTIIIPVSAFGISVIIAVILTCLTCRNAAIRRQRRENEVEMESCSQSP
NT seq 891 nt   +upstreamnt  +downstreamnt
atgggtcacacaatgaagtggggaacactaccacccaagcgcccatgcctctggctctct
cagctcttggtgctcactggtcttttttacttctgttcaggcatcaccccaaagagtgtg
accaaaagagtgaaagaaacagtaatgctatcctgtgattacaacacatccactgaagaa
ctgacaagccttcggatctattggcaaaaggatagtaaaatggtgctggccatcctgcct
ggaaaagtgcaggtgtggcctgaatacaagaaccgcaccatcactgacatgaacgataac
ccccgcattgtgatcctggctctgcgcctgtcggacagtggcacctacacctgtgttatt
cagaagcctgatttgaaaggggcttataaactggagcacctgacttccgtgaggttaatg
atcagagctgacttccctgtccctaccataaatgatcttggaaatccatctcctaatatc
agaaggctaatttgctcaacctctggaggttttccaaggccccacctctactggttggaa
aatggagaagaattaaatgctaccaacacaacactgtcccaagatcctgaaaccaagctc
tacatgattagcagtgaactggatttcaacatgacaagcaatcacagcttcttgtgtctt
gtcaagtatggagacttaacagtgtcacagaccttctactggcaagaatccaaaccaacc
ccttctgctaatcagcacctgacctggaccattattatcccagtctcagcatttgggatt
tctgtgatcattgcagttatactaacatgcctgacctgcagaaatgctgcaatacgcaga
cagagaagggagaatgaagtggaaatggaaagttgctctcagtctccatag

DBGET integrated database retrieval system