KEGG   Bos indicus (zebu cattle): 109554463
Entry
109554463         CDS       T04792                                 

Gene name
JAM3
Definition
(RefSeq) junctional adhesion molecule C
  KO
K06785  junctional adhesion molecule 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109554463 (JAM3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109554463 (JAM3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109554463 (JAM3)
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set Izumo-Ig C2-set_2 Ig_6
Other DBs
NCBI-GeneID: 109554463
NCBI-ProteinID: XP_019810535
Position
29
AA seq 302 aa
MALRRRPSLVLLLLLVRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTNDPRIEWK
KIQDEQTTYVFFDNKIQGDLTDRAELLGKTSLKIWNVTRKDSALYRCEVVARNDRKEIDE
IVIELTVQVKPVAPVCRVPRAVPVGKAATLSCQEGEGFPRPHYSWYRNDVPLPTDSRANP
RFRNSSFVLNPETGTLVFSAVHKEDSGQYYCIASNDAGSARCEEQDMEVYDLNIGGIIGG
VLVVLTVLALITGGICCAYRRGYFISHDRSGESYKNPGKPDGVNYIRTDEEGDFRHKSSF
VI
NT seq 909 nt   +upstreamnt  +downstreamnt
atggcgctgaggcgaaggccctccctggtcctgctgctgttgctcgtgcggggctgcttg
atcggggctgtgaatctcaaatccagcaaccgaaccccagtggttcaggaatttgaaagt
gtggaactatcttgtatcattacggattcacagacaaatgaccccaggattgaatggaag
aagatccaagatgaacaaaccacctatgtgtttttcgacaacaagattcagggagacctg
accgaccgtgcagagctgctggggaagacgtctctgaagatctggaacgtgacgaggaaa
gactcggccctttaccgctgcgaggtggttgctcggaatgaccgcaaggagatcgacgag
atcgtcatcgagttgaccgtgcaagtgaagccggtggccccggtgtgcagggtgccaagg
gccgtgcctgtgggcaaggcggccaccctgtcctgccaggagggcgagggcttcccgcgg
ccgcactacagctggtaccgcaatgacgtgccactgcccacagactccagggccaacccc
cgctttcgaaactcctctttcgtcttaaaccctgagacgggcactctggtgttcagcgcc
gtccacaaggaggactcaggccagtactactgcatcgcatccaacgacgcgggctcggcg
cgctgcgaggagcaggacatggaagtgtatgacctcaacatcggcggcatcattgggggg
gtcctagtcgtgctgaccgtcctggccctcatcacagggggcatctgctgtgcctataga
cgtggctacttcatcagccacgaccggagcggggaaagctacaagaacccagggaagcca
gatggagttaactacatcaggacagatgaggagggtgacttcagacacaagtcctcgttc
gtgatctag

DBGET integrated database retrieval system