KEGG   Bos indicus (zebu cattle): 109554508
Entry
109554508         CDS       T04792                                 

Gene name
CAPN1
Definition
(RefSeq) calpain-1 catalytic subunit
  KO
K01367  calpain-1 [EC:3.4.22.52]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04141  Protein processing in endoplasmic reticulum
biu04210  Apoptosis
biu04217  Necroptosis
biu04218  Cellular senescence
biu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109554508 (CAPN1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109554508 (CAPN1)
   04217 Necroptosis
    109554508 (CAPN1)
   04218 Cellular senescence
    109554508 (CAPN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109554508 (CAPN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109554508 (CAPN1)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     109554508 (CAPN1)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C2: calpain family
   109554508 (CAPN1)
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_6 EF-hand_8 EF-hand_1 EF-hand_7
Other DBs
NCBI-GeneID: 109554508
NCBI-ProteinID: XP_019810615
Position
29
AA seq 716 aa
MAEEFITPVYCTGVSAQVQKQRAKELGLGRHENAIKYLGQDYEQLRVHCLQRGALFRDEA
FPPVPQSLGFKELGPNSSKTYGIKWKRPTELFSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQDGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYNIILK
ALERGSLLGCSIDISSILDMEAVTFKKLVKGHAYSVTGAKQVNYQGQMVNLIRMRNPWGE
VEWTGAWSDGSSEWNGVDPYMREQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
QRFRNWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEETDDPDPDDYGGRESGCS
FLLALMQKHRRRERRFGRDMETIGFAVYEVPPELMGQPAVHLKRDFFLSNASRARSEQFI
NLREVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTQELDDQVQANLPDEQVL
SEEEIDENFKSLFRQLAGEDMEISVKELRTILNRIISKHKDLRTTGFSLESCRSMVNLMD
RDGNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIEFAGFKLNKKLYEL
IITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2151 nt   +upstreamnt  +downstreamnt
atggccgaggagttcatcactccggtgtactgcaccggggtgtctgcacaagtgcagaag
cagcgggccaaggagctgggcctgggccgccatgaaaatgccatcaagtacctgggccag
gattacgagcagctgcgggttcactgcctgcaaagaggggcccttttccgtgacgaggct
ttccccccagtgccccagagcctgggcttcaaggagctgggccccaactcctccaaaacc
tatggcatcaagtggaagcgtcccacggagctgttctcaaacccccagttcatcgtggat
ggagccacccgcacggacatctgccagggygcactgggggactgttggctcctggctgcc
atcgcctcccttaccctcaatgacaccctcctgcaccgagtagttccacatggccaaagc
ttccaggatggctacgctggcatcttccatttccagctgtggcagtttggtgagtgggtg
gatgtggtggtggatgacctgctgcccaccaaggacgggaagctggtgtttgtgcactct
gcccaaggcaacgagttctggagcgccctgctggagaaggcctatgccaaggtgaacggc
agctacgaggccctctcaggaggcagcacrtctgagggctttgaggacttcaccggcgga
gtcaccgagtggtacgagctgcgcaaggcgcccagcgacctctacaacatcatcctcaag
gccctggagcgtggctccctgctgggctgctccatcgatatctccagcattctggacatg
gaggctgtcaccttcaagaagctggtgaagggccacgcctactctgtgaccggggccaaa
caggtgaactaccagggccagatggtgaacctgatccggatgcggaacccctggggcgag
gtggagtggacaggagcctggagtgacggctcctcggagtggaacggcgtggacccttac
atgcgggagcagctccgggtcaagatggaggatggggagttctggatgtcattccgagac
ttcatgcgtgaattcacccgcctggagatctgcaacctgacacccgacgcgctcaagagc
cagaggttccgcaactggaacaccaccctgtaygagggcacctggcggcgggggagcacc
gcggggggctgccgcaactacccagccactttctgggtgaacccccagttcaagatccgg
ctggaggagacggatgacccggaccccgacgactacgggggtcgcgagtcaggctgcagc
ttcctgctcgccctcatgcagaagcaccgccgtcgggagcgccgtttcggccgtgacatg
gagaccataggcttcgctgtctacgaggtccctccggagctgatgggccagccggccgtg
catctgaagcgggacttcttcctgtccaacgcctcccgggcccggtccgagcagttcatc
aacctgcgggaggtcagcacccgcttccgcctgccgcctggggagtacgtggtggtgccc
tccaccttcgagcccaacaaggaaggtgactttgtgctgcgtttcttctcagagaagagc
gcagggacccaagagctggatgaycaggtccaggccaatctccccgacgagcaagtgctc
tcagaagaggagattgatgagaacttcaagtccctcttcagacaactggcaggggaggac
atggagatcagcgtcaaggagctgcggaccatcctcaacaggatcatcagcaaacacaaa
gacctgcggaccacgggcttcagcctggagtcctgccgcagcatggtcaacctcatggat
cgcgacggcaatggcaaactgggcctggtggagttcaacatcctatggaaccggatccgg
aattacctgtccatcttccggaagtttgacctggacaagtcgggcagcatgagtgcctat
gaaatgcggatggccattgagtttgcaggcttcaagctcaacaagaagctgtacgagctc
attatcacccgctactcggagcccgacctggccgtggacttcgacaacttcgtgtgctgc
ctggtgcggctggagaccatgttccggtttttcaaaactctggacactgatctggatgga
gtggtgacctttgacttgtttaagtggttacagctgaccatgtttgcgtga

KEGG   Bos indicus (zebu cattle): 109570370
Entry
109570370         CDS       T04792                                 

Gene name
CAPN2
Definition
(RefSeq) calpain-2 catalytic subunit
  KO
K03853  calpain-2 [EC:3.4.22.53]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04141  Protein processing in endoplasmic reticulum
biu04210  Apoptosis
biu04217  Necroptosis
biu04218  Cellular senescence
biu04510  Focal adhesion
biu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109570370 (CAPN2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109570370 (CAPN2)
   04217 Necroptosis
    109570370 (CAPN2)
   04218 Cellular senescence
    109570370 (CAPN2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109570370 (CAPN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109570370 (CAPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109570370 (CAPN2)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.53  calpain-2
     109570370 (CAPN2)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C2: calpain family
   109570370 (CAPN2)
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_7
Other DBs
NCBI-GeneID: 109570370
NCBI-ProteinID: XP_019831825
Position
16
AA seq 700 aa
MAGIAAKLAKDREAAEGLGSHERAVKYLNQDYAALRDECLEAGALFQDPSFPALPSSLGF
KELGPYSSKTRGIEWKRPTEICDNPQFITGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLDQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELRKAPPNLFRIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESRGSLQKLIRIRNPWGEVEWTGQWNDN
CPNWNTVDPEVRETLTRQHEDGEFWMSFNDFLRHYSRLEICNLTPDTLTSDSYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDQEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELTGQTNIHLSKKFFLTTRARERSDTFINLREVLNRFKLPPG
EYIVVPSTFEPNKDGDFCIRVFSEKKADYQVVDDEIEANIDEIDISEDDIDDGFRRLFAQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDDLIIDFD
NFVRCLIRLETLFRIFKQLDPENTGMIQLDLISWLSFSVL
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggcgggcatcgcggccaagctggcgaaggaccgggaggcggccgaggggctgggctcg
cacgagagggcggtcaagtacctcaaccaggactacgcggcgctgcgggacgagtgcctg
gaggccggggcgctgttccaggacccctccttcccggccctgccgtcytccctgggcttc
aaggagttgggaccttactccagcaaracccggggcatcgagtggaagcggcccacggag
atctgcgataatccccaatttattactggaggagccactcgcacagacatctgccaagga
gccctaggtgactgctggctgctggccgcaattgcctccctcactttgaatgaagaaatc
ctggctcgagtcgtccccctggaccagagcttccaggagaactatgcggggatcttccac
ttccagttctggcagtacggcgagtgggtggaggtggtggtggacgacaggctgcccacc
aaggacggggagctgctcttcgtgcactcggcagagggcagcgagttctggagtgcgctg
ctggagaaggcctacgccaagatcaatgggtgttatgaagcactttcggggggcgccacc
acygagggcttcgaggacttcactggaggcatcgctgagtggtatgagttgaggaaggcc
cctcccaacctgttcaggatcatccagaaggctctgcagaaaggctctctcctgggctgc
tccatcgatatcaccagcgctgcggactcggaggccatcacgttccagaagctggtgaag
gggcacgcgtactcggtgaccggtgccgaggaggtggaaagcagaggaagcctgcagaag
ctgatccgcatccggaatccctggggagaggtggagtggaccgggcagtggaatgacaac
tgcccaaactggaacacagtcgaccccgaggtgagggaaacgctgactagacagcatgag
gatggggaattctggatgtctttcaacgacttcctgagacactattcccgcctggaaatc
tgcaacctgacccctgacacactcaccagtgacagctacaagaagtggaaactcaccaag
atggatgggaactggaggcggggctccaccgcgggcggctgcaggaactacccgaacacg
ttctggatgaatcctcagtacctgatcaagctggaggaagaggacgaggaccaggaggac
ggggagagcggctgcaccttcctggtgggcctcatccagaagcaccggcggcggcagagg
aagatgggcgaggacatgcacaccattggcttcggcatctatgaggttccagaggagttg
actggacagaccaacatccacctcagcaaaaaattcttcctgacaaccagagcgcgggag
cggtcggacaccttcatcaacctgcgggaggtgctcaaccgcttcaagctgccccccggg
gagtacatygtggtgccctccaccttcgagcccaacaaggacggcgacttctgcatccgg
gtcttttccgagaagaaagccgactaccaagttgtcgacgatgaaatcgaggccaacatt
gacgagattgacatcagcgaggatgacatcgatgatggattcaggagactgttcgcccag
ctggccggagaggaygcagagatttctgcctttgagttgcagacaatcctgagaagagtg
ctagcaaagcgccaagatatcaagtccgacggctttagcattgagacctgcaaaatcatg
gtggacatgctcgactcggatgggagtggcaaactgggtctgaaggagttctacattctc
tggacgaagattcagaaataccaaaaaatttaccgggaaattgatgtggaccggtctgga
accatgaactcctatgagatgcggaaagcattagaagaagcaggtttcaagatgccctgt
cagctccaccaagtgattgtcgcccggtttgcagatgacgacctcatcatcgattttgac
aattttgtccggtgtttgattcgactggagacactgttcaggatatttaagcagctggac
cccgagaatactggaatgatccagcttgaccttatctcttggctgtctttttcagtactt
tga

DBGET integrated database retrieval system