KEGG   Bos indicus (zebu cattle): 109555123
Entry
109555123         CDS       T04792                                 

Gene name
CD99L2
Definition
(RefSeq) CD99 antigen-like protein 2
  KO
K06520  CD99 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109555123 (CD99L2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109555123 (CD99L2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109555123 (CD99L2)
CD molecules [BR:biu04090]
 Proteins
  109555123 (CD99L2)
SSDB
Motif
Pfam: CD99L2 BT1
Other DBs
NCBI-GeneID: 109555123
NCBI-ProteinID: XP_019811259
Position
X
AA seq 82 aa
MSAETGTIACVASALAMALIGAVSSYISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEP
QVKYSALQTQSTEPPPPEPPRI
NT seq 249 nt   +upstreamnt  +downstreamnt
atgtcggcagagactggcaccatcgcctgcgttgccagcgctctggccatggcgctgatc
ggtgctgtatccagttacatctcctaccagcagaagaagttctgcttcagcatacagcag
ggtctcaatgcggactacgtgaaaggggagaacctggaggccgtcgtatgtgaggagccc
caagtgaaatactcggccctgcagacgcagtccacggagccgccaccccctgaaccaccc
cggatctga

DBGET integrated database retrieval system