KEGG   Bos indicus (zebu cattle): 109555382
Entry
109555382         CDS       T04792                                 

Gene name
MCL1
Definition
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04630  JAK-STAT signaling pathway
biu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109555382 (MCL1)
   04151 PI3K-Akt signaling pathway
    109555382 (MCL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109555382 (MCL1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    109555382 (MCL1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 109555382
NCBI-ProteinID: XP_019811786
Position
3
AA seq 196 aa
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLATGAKDAKPLGGSGTTSRKALETLR
RVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFV
AKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLA
FAGVAGVGAGLAYLIR
NT seq 591 nt   +upstreamnt  +downstreamnt
atgttcggcctcaagagaaacgcagtaatcggactaaacctctattgtgggggagccgga
ttaggacagggcagcggcgcctcctctccgggggggcggcttttggcaaccggcgccaag
gacgcgaagcccctgggcgggtctgggaccacaagccggaaggcgttggagaccctgcgc
cgagtcggggatggggtgcagcgcaaccacgagacggctttccaaggcatgcttcggaaa
ctggacatcaaaaatgaagacgatgtcaaatctttgtctcgagtgatggttcatgttttc
agtgacggagtaacaaactggggcaggattgtgactcttatttcttttggtgcctttgtg
gccaaacacttgaagagtataaatcaagaaagctgcatcgaaccactagcagaaagcatc
acagatgttctcgtaaggtcaaaacgagactggatagtcaaacaaagaggctgggatggg
tttgtggagttcttccatgtagaggacctagaaggcggcatcagaaatgtgctgctggct
tttgcaggtgttgccggagtaggagctggtttggcatatctaataagatag

KEGG   Bos indicus (zebu cattle): 109564155
Entry
109564155         CDS       T04792                                 

Definition
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1 homolog
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04630  JAK-STAT signaling pathway
biu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109564155
   04151 PI3K-Akt signaling pathway
    109564155
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109564155
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    109564155
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 CRISPR_Cas6 M11L
Other DBs
NCBI-GeneID: 109564155
NCBI-ProteinID: XP_019823277
Position
10
AA seq 260 aa
MCGFFQGQGETNWFGIAEEMESLISDAIMSPEEEPDGCKPDPLGKRPAVRPLPLLVREAS
NNSPGSDGSLPSTPPPAEEEEDELYWQSLEIISRYLREQATGAKDVKPLGGSGATSRKAL
ETLHRVGDGVQHNHETAFQGMLQKLDIKNEDDVKSLSRVMVHVFSDRVTNWGRIVTLISF
GAFVAKHFKSINQESCIEPLAESITDVLVRSKRDWIVKERGWXGFVEFFHVEDLEGGIRN
VLLAFAGVAGVGAGLAYLIR
NT seq 783 nt   +upstreamnt  +downstreamnt
atgtgtggcttctttcaaggacagggggaaacaaactggtttggtatagctgaagagatg
gaatccctgatctccgatgccatcatgtcgcccgaagaggagccggacgggtgcaagcca
gaccctctcgggaagcggcctgccgtccggcctttacctttgttggtcagagaagccagt
aacaacagtccaggctcggacggctcgctgccctcgacgccgcccccagcagaggaggag
gaggacgagttatattggcagtccctggagattatctctcggtacctccgggagcaggca
accggcgccaaggatgtgaagcccctgggcgggtctggggccaccagccggaaggcgttg
gagaccctgcaccgagtcggggatggggtgcagcacaaccacgagacggctttccaaggc
atgcttcagaaactggacatcaaaaacgaagacgatgttaaatctttgtctcgagtgatg
gttcatgttttcagtgacagagtaacaaactggggcaggattgtgactcttatttctttt
ggtgcctttgtggccaaacactttaagagtataaatcaagaaagctgcatcgaaccacta
gcagaaagcatcacagatgttctcgtaaggtcaaaacgagactggatagtcaaagaaaga
ggctggkatgggtttgtggagttcttccatgtagaggacctagaaggcggcatcagaaat
gtgctgctggcttttgcaggtgttgccggagtaggagctggtttggcatatctaataaga
tag

DBGET integrated database retrieval system