KEGG   Bos indicus (zebu cattle): 109555385
Entry
109555385         CDS       T04792                                 

Gene name
F9
Definition
(RefSeq) coagulation factor IX
  KO
K01321  coagulation factor IX (Christmas factor) [EC:3.4.21.22]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109555385 (F9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109555385 (F9)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.22  coagulation factor IXa
     109555385 (F9)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109555385 (F9)
SSDB
Motif
Pfam: Trypsin Gla FXa_inhibition EGF cEGF Trypsin_2 DUF1986 hEGF
Other DBs
NCBI-GeneID: 109555385
NCBI-ProteinID: XP_019811788
Position
X
AA seq 462 aa
MWCLNMIMAESPGLVTICLLGYLLSAECTVFLDRENATKILHRPKRYNSGKLEEFVRGNL
ERECKEEKCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGGMCKDDINSYECWCQ
AGFEGTNCELDATCSIKNGRCKQFCKRDTDNKVVCSCTDGYRLAEDQKSCEPAVPFPCGR
VSVSHISKKLTRAETIFSNTNYENSSEAEIIWDNVTQSNQSFDEFSRVVGGEDAERGQFP
WQVLLHGEIAAFCGGSIVNEKWVVTAAHCIKPGVKITVVAGEHNTEKPEPTEQKRNVIRA
IPYHSYNASINKYSHDIALLELDEPLELNSYVTPICIADRDYTNIFLKFGYGYVSGWGKV
FNRGRSASILQYLKVPLVDRATCLRSTKFSIYSHMFCAGYHEGGKDSCQGDSGGPHVTEV
EGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtggtgcctgaacatgatcatggcagaatcaccgggcctcgtcaccatctgcctttta
ggatatctactcagtgctgaatgtacagtttttcttgaccgtgaaaatgccaccaaaatt
ctccatcggccaaagaggtacaattcaggtaaattggaagagtttgttcgagggaacctt
gagagagaatgtaaagaagaaaaatgtagttttgaagaagcacgagaagtttttgaaaac
actgagaaaactactgaattttggaagcaatatgttgatggagatcagtgtgaatccaat
ccatgtttaaatggcggcatgtgcaaggatgacattaattcctatgaatgttggtgtcaa
gctggatttgaaggaacgaactgtgaattagatgcaacatgcagcattaagaatggcaga
tgcaagcagttttgtaaaagggacacagataacaaggtggtttgttcctgtactgacgga
taccgacttgcagaagaccaaaagtcctgcgaaccagcagtgccatttccctgtggacga
gtctctgtctcacatatttctaagaagctcacccgtgctgagactattttttccaatacg
aactatgaaaattcttctgaggctgaaataatttgggataacgtcactcaaagcaaccaa
tcattcgatgagttcagtcgtgtggttggtggagaagatgctgaaagaggtcaattccct
tggcaggtccttttgcatggtgaaattgctgcattctgtggaggttccatcgttaatgaa
aaatgggttgtaactgcagcccactgcatcaagcctggtgttaaaattactgttgttgca
ggtgagcataacaccgagaagccagaacctacagagcaaaagcgaaatgtgatccgtgct
attccttaccacagctacaacgcatctattaataagtacagccacgacattgccctcctg
gagctggatgaacccttagagctaaatagctatgtaacccctatttgcattgctgacagg
gactacacgaacatcttccttaaatttggttatggttatgtgagtggctggggcaaagtc
ttcaacagagggaggtcagcctcaattctccagtacctgaaagttccacttgttgaccga
gcyacgtgtcttcgatccacaaagttcagcatctacagtcacatgttctgtgctggctac
catgagggaggtaaagattcatgccaaggagacagtgggggaccccatgttaccgaagtg
gaaggtaccagtttcttaactggaattattagctggggtgaagagtgtgcaatgaaagga
aaatatggcatatataccaaggtgtcccggtatgtcaactggattaaggaaaaaacaaag
ctcacataa

DBGET integrated database retrieval system