KEGG   Bos indicus (zebu cattle): 109555392
Entry
109555392         CDS       T04792                                 

Gene name
L1CAM
Definition
(RefSeq) neural cell adhesion molecule L1 isoform X1
  KO
K06550  L1 cell adhesion molecule
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04360  Axon guidance
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109555392 (L1CAM)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    109555392 (L1CAM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109555392 (L1CAM)
   04090 CD molecules [BR:biu04090]
    109555392 (L1CAM)
   04091 Lectins [BR:biu04091]
    109555392 (L1CAM)
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  L1 family
   109555392 (L1CAM)
CD molecules [BR:biu04090]
 Proteins
  109555392 (L1CAM)
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109555392 (L1CAM)
SSDB
Motif
Pfam: Ig_3 I-set fn3 Ig_2 ig Bravo_FIGEY V-set Ig_5 C2-set_2 Ig_6 BiPBP_C DUF4719
Other DBs
NCBI-GeneID: 109555392
NCBI-ProteinID: XP_019811800
Position
X
AA seq 1391 aa
MFPRRPCMPCASCKLQSFLLPGSCGTWWRGEGGRLCSVSSRWVSSLAFHLSLVVHPSLWS
SSLPVRGLPSLVLLPLASPVSLFFLSHALSFCLASSLSSGFFLCDFWCHLLSVLVPSTFA
QLLWAQLAPPRPTTQWPCGLSGSRPGFCPHGTRVRAEVLTMSVPPPAPVMEPPIITEQSP
RRVVVFPTDDVSLKCEASGKPEVQFRWTRDGILFKPREELGMIVNQVPHSGSFSITGNSS
NFAQSFQGTYRCFASNKLGTAMSHEIQLMAEGTPKWPKETVKPVEVEEGESVILPCHPPP
SAEPLRIYWMNSKILHIKQDERVTMGQNGNLYFANVLTSDNHSDYICHAHFPGTRTIIQK
EPIDLRVKATNSMMDRKPHLLFPTNSSSHLVALQGQPLILECIAEGFPTPTIKWLRPSGP
MPADRVTYQNHNKTLQLLNVGEEDDGEYRCLAENSLGSDRHAXYVTVEAAPYWLHKPQSH
LYGPGETARLDCQVQGRPQPEVTWRINGIPVEELGKDQKYRIHHGALVLSNLQPSDTMVT
QCEARNRHGLLLANAYIYVVELPAKILTPDNETYMAVQGSTAYLLCKAFGAPVPSVQWLD
REGKTVLQDXRFFPYTNGTLGIRDLQTNDTGHYFCQAANDQSNVTIVANLQVKDATRIMQ
GPRSAIEKRGSRVMFTCQASFDPSLQHSTTWRRDALDLQELGDSDKYFIEDERLVIHSLD
YSDQGNYSCVASTKLDVVESRAELLVVGSPGPVPQLELSDHHLLKQSQVRLSWSPADDHN
APIEKYDIEFEDKEMAPEKWYSLGKVPGNQTSTTLKLSPYVHYTFRVTAINKYGPGEPSP
DSETVVTPEAAPEKNPVDVKGEGNETNNMVITWKPLRWMDWNAPQVQYRVQWRPQKMQGA
WQEQIVSDPFLVVSNTSTFVPYEIKVQTVNSQGKGPEPQITIGYSGEDYPQASPLLEPVK
ALNSSTVLVRWQSVDPAQVKGHLRGYNVTYWWEGSQRKHNKRHVHKGHVVVPANATSTIL
GGLRPYSSYWVEVQAFNGRGLGPASGMTFNTPEGVPGHPEALHLECQSDTSLLLHXQPPL
SHNGVLTGYVLSYQPLNDGSKEQLSFDLPDPELRTHNLTNLSPRLRYRFQLQATTREGPG
EAIVREGGTMALSGMPDFGNISAMAGENYSVVSWVPKEGQCNFGFQIWFKALGDEKLVAR
LPPQYVSYNQSSYTQWDLQPDTDYEIQLLKEQVLLHQMAVKTNGTGRVRLPPAGFATEGW
FIGFISAIVVLLLVLLILCFIKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYSDNEEK
AFGSSQPSLNGDIKPLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEVAGGNDSSGA
TSPINPAGTLE
NT seq 4176 nt   +upstreamnt  +downstreamnt
atgtttcccaggaggccctgtatgccttgtgcctcatgcaagctgcagtcttttctgctt
cctgggtcctgtggcacctggtggcggggggaaggggggcggctttgttctgtctccagc
aggtgggtttcctccctggctttccacttgtctctggtggtccacccttccctctggtcc
tcctcyctccccgtgaggggtttgccctcgttggtgcttctgcctttggcttcccctgtc
tctcttttctttctttcacatgctttgtctttctgtttggcttcttctctctcttctggt
ttctttctctgtgacttttggtgccatcttctctctgttctggtcccttccacctttgcc
cagctgctttgggctcaacttgctcctccccgccccaccacccaatggccatgcggcctg
tcaggctccagacctggcttctgtccccatgggacaagggtgagggccgargtgctcact
atgtctgtcccccctcctgccccagtgatggaaccccccatcatcacggagcagtctccc
cggcgtgtggtcgtcttccccacagatgacgtcagcctcaagtgtgaggccagcggcaaa
cccgaagtgcagtttcgctggactcgggatggcatcctcttcaaacccagagaggaactg
ggcatgatcgtgaaccaggtgccccattctggctccttcagcatcacgggcaacagcagc
aactttgcccagagcttccagggcacctatcgctgctttgccagcaacaagctgggcacc
gccatgtcccacgagatccagctcatggccgagggtacccccaagtggccaaaggagaca
gtgaaacctgttgaggtcgaggaaggggagtcggtgattctcccttgccacccgcccccc
agtgcagagccactccggatctactggatgaacagcaagatcttgcacatcaaacaggat
gagcgggtgaccatgggccagaatggcaacctctactttgctaatgtgctcacctcggac
aaccactcagactacatctgtcacgcccacttccctggcacccgaaccatcattcaaaag
gaacccattgacctccgggtcaaagcgaccaacagcatgatggacagaaaaccacacttg
ctcttccccaccaattccagcagccacctggtggccctgcaggggcagcccttgatcttg
gagtgcatagctgagggcttccccacgcccaccatcaagtggctgcgcccaagcggcccc
atgccagccgaccgggtcacctaccagaaccacaacaagacgctgcagttgctgaacgtg
ggtgaggaggacgacggcgagtaccgctgcctggctgagaactcgctgggcagcgaccgc
cacgccyactacgtcaccgtggaggctgcaccatactggctacacaagccccagagccat
ctgtacgggccaggggagactgcccgcctagactgtcaagtgcagggcaggccccaaccg
gaggtcacctggagaatcaatgggatccctgtggaggagctgggcaaggaccagaaatac
cggatccaccatggagccctggtcctgagcaatctgcagcccagtgacactatggtgacc
cagtgtgaggcccgcaaccgccacgggctcctgctggccaatgcctacatctatgttgtg
gagctgccagccaagatcctgaccccagacaatgagacatacatggcagtccagggcagc
accgcctaccttctgtgcaaggccttcggagcccctgtgcccagcgtccagtggctggac
agggaaggaaagacagtgctgcaggacgrgcgcttcttcccctacaccaacgggaccctg
ggcatccgagacctccagaccaatgacactgggcactacttctgccaggctgccaacgac
caaagcaacgtgaccattgtggctaacctgcaggtcaaagatgccactcggatcatgcag
gggccccgcagtgcaatcgagaagagaggctcccgagtgatgttcacatgccaggcctcc
tttgacccctccctgcagcacagcaccacctggcgcagggatgctctcgacctgcaggag
ttgggggacagtgacaagtacttcatagaagacgagcgcttggtcatccacagcctggac
tacagtgaccagggcaactacagctgcgtggccagcaccaagctggacgtggtggagagc
cgggcagagctgctggtggtcgggagccccggacctgtgccccagctggagctgtctgat
caccacctgctgaagcagagccaggtgcgcctgtcttggagcccagctgatgaccataac
gcccccattgagaagtatgacattgaatttgaggacaaggagatggcacccgagaagtgg
tacagcctgggcaaggtgcccggaaaccagacctccaccaccctcaagctgtcgccttat
gtccactatacctttcgagtcactgccatcaacaaatatggccctggggagcccagcccg
gactctgagactgtggtcacgccggaggcagccccagagaagaaccccgtggacgtgaag
ggggaaggaaatgagaccaacaacatggtcatcacttggaagccgctgcggtggatggac
tggaatgccccccaggttcagtatcgagtgcagtggcgcccccagaagatgcagggggcc
tggcaggaacagatcgtcagtgaccccttcctggtggtgtccaatacatctacctttgtg
ccgtatgagatcaaagtccagaccgtcaacagccagggcaagggccctgagccccagatc
accatcggctactctggagaggactacccccaggcaagccctctgctggaacccgtcaag
gccctcaattcaagcactgtgctggtcaggtggcagtctgtggacccagcccaggtcaaa
ggccacctccggggatacaatgtgacgtactggtgggaaggcagtcagaggaagcacaac
aagaggcacgtccacaaaggccacgtggtggtgccagccaatgccaccagcaccatcctg
ggaggcctgcggccctatagctcctactgggtagaggttcaggcctttaacgggagggga
ctggggcctgccagtgggatgaccttcaacacccctgagggagtgcctggacaccctgag
gcgttgcacctggagtgccagtcagataccagcctgctgctgcactrgcagcctccgctc
agccataatggtgtgctcacgggctacgtgctctcctaccaacctttgaatgacgggagc
aaggagcagttgtcctttgacctcccggaccctgagctgcggacacacaacctgaccaac
ctcagcccccgcctgcggtaccgattccagctgcaggccaccacgagggagggcccgggg
gaggcgatcgtacgggaaggaggcaccatggccttgtccgggatgccggactttggcaac
atctccgccatggctggcgagaattacagtgtggtctcctgggtccccaaagagggccag
tgcaacttcgggttccagatctggttcaaagccctgggggacgagaagctggtggctcgt
ctcccaccgcagtacgtcagctacaaccagagctcctacacacagtgggacctgcagcct
gacaccgactatgagatccagctgctcaaggagcaggtgctcctgcaccagatggcagtg
aagaccaacggcaccggccgagtgaggctgcctcccgctggctttgccactgagggctgg
ttcatcggcttcatcagtgccatcgttgtcctgcttcttgtcttactcatcctgtgcttc
attaagcgcagcaagggtggcaagtactcggtgaaggacaaggaggacacccaggtggac
tcagaggcccggcccatgaaggacgaaaccttcggcgagtacagtgacaatgaggagaag
gcctttggtagcagccagccatcactcaacggagacatcaagcccctgggcagtgatgac
agcctggcggactacggaggcagcgtggacgtccagttcaatgaggatggctccttcatc
ggccagtacagtggcaagaaggagaaggaggtggcagggggcaatgacagctccggggcc
acatcccccatcaaccccgccgggaccctggagtag

DBGET integrated database retrieval system