KEGG   Bos indicus (zebu cattle): 109555456
Entry
109555456         CDS       T04792                                 

Gene name
VSIG4
Definition
(RefSeq) V-set and immunoglobulin domain-containing protein 4 isoform X1
  KO
K19822  V-set and immunoglobulin domain-containing protein 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109555456 (VSIG4)
SSDB
Motif
Pfam: V-set Ig_3 ig V-set_CD47 Ig_2 I-set
Other DBs
NCBI-GeneID: 109555456
NCBI-ProteinID: XP_019811913
Position
X
AA seq 305 aa
MGLLLGLLLLSHLLVVIYGHPILEVPESVTGPWKGDVNIPCTYGPLQGYTQVLVKWLVER
GSDSVTIFLRDPSGDHIQQAKYRGRLHVNHEVPGDVSLQLNTLEMDDRSHYTCEVTWQTP
DGNQVVRDKIVELRVQKHSSKPLETKTKSLPTMQTPLEAAYTVNISWGRITEMDGDIGKT
SAGPGKGLSIFAIILIISLCCIVFITMTYIMVCRKTSQQDHVYEVARFHAREASDSGETM
RVALFTSGCSDEEPASQTLGNDYSDEPCLGQEYQIITQINSDYAHLLHTDSLDYELLATK
VKNVC
NT seq 918 nt   +upstreamnt  +downstreamnt
atggggctcttactgggcctgctgctcctgagccacctactggtggtcatctatggacat
cccatcctggaagtgcctgagagtgtkactgggccttggaaaggggatgtaaatattccc
tgtacctatggtcctctgcaagggtatacacaagtcttagtaaagtggctggtagaacgt
ggatctgactcagtcaccatttttctacgtgacccctctggagaccatattcagcaagca
aagtaccggggccgcctgcatgtaaatcatgaggttccaggagatgtgtccctccaactg
aataccctggagatggatgaccggagccactacacatgtgaagtcacttggcagactcct
gatggcaaccaagttgtgagagataaaatcgttgaactccgagtccagaaacattcctca
aagccacttgagaccaagactaagtcacttccaaccatgcaaacccccttggaagcagca
tacacagtgaatatatcctggggcagaataactgaaatggatggtgatattggaaagaca
agtgctggaccaggaaaaggcctgtctatctttgccataattctcatcatctccttgtgc
tgtatagtgttcatcaccatgacttatatcatggtctgcaggaagacatcccaacaggat
catgtctatgaagtggccaggtttcatgccagggaggccagtgactctggtgaaacaatg
agggtggccctcttcacaagtggctgctccgatgaagagccagcttcccagactctgggc
aatgactactctgacgagccttgcctgggccaggagtaccagatcatcacccagatcaac
agtgactatgctcatctgctgcatacagattccctggattatgagcttctagccaccaag
gtcaagaatgtctgctaa

DBGET integrated database retrieval system