KEGG   Bos indicus (zebu cattle): 109555468
Entry
109555468         CDS       T04792                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04080  Neuroactive ligand-receptor interaction
biu04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109555468 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109555468 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 109555468
NCBI-ProteinID: XP_019811931
Position
X
AA seq 77 aa
MNLRRCVQALLLLWLCLSAVCGGPLLQTSDGKEMEEGTIRYLVQPRGPRSGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggcgctgcgtgcaggcgctcctgctgctctggctctgcctgagcgcggtg
tgcggaggacccctgctgcagacttctgacgggaaggagatggaagaaggcaccatccga
tacctggtgcagcccagggggccgaggagcggcccaggcccctggcagggaggtcggagg
aagttccggcgccagcggccacgcctctcccacaagggtcccatgcctttctga

DBGET integrated database retrieval system